KEGG   Campylobacter cuniculorum: CCUN_0657Help
Entry
CCUN_0657         CDS       T05046                                 

Gene name
waaD
Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
ccun  Campylobacter cuniculorum
Pathway
ccun00540  Lipopolysaccharide biosynthesis
ccun01100  Metabolic pathways
Module
ccun_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:ccun00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CCUN_0657 (waaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ccun01005]
    CCUN_0657 (waaD)
Enzymes [BR:ccun01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     CCUN_0657 (waaD)
Lipopolysaccharide biosynthesis proteins [BR:ccun01005]
 Unusual sugar
  CCUN_0657 (waaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 DUF5305
Motif
Other DBs
NCBI-ProteinID: ARJ56280
UniProt: A0A1W6BW43
Position
complement(650474..651433)
Genome map
AA seq 319 aa AA seqDB search
MRILITGGAGFIGSQLALFLQDKNEILIIDKMRGKESFENGNLQCLGHFKNLLEFKGELF
IGDILDEKTLRIMREFKPEVIFHQAAISDTTANNQNQILNVNLNSFKDLIKLSIELNAKL
IYASSASVYGDAKSPQSVGFGEKPKNVYAFSKLMMENLATKFYDKAHLVGLRYFNVYGKG
EFFKGKTSSMILQFAHQILSAKAPRLFEGSDKIYRDFVYIKDVINANLAALNAKSGVYNV
GSGVARTFKEVADILQKELGTNYSYEIIPNPYKNAYQYHTQAKLEQNFAYTPQFSLEEGI
KDYLSEIKRLFEEESKAHV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaggattttaatcacaggaggagctggatttatcggctctcaactcgcacttttttta
caagataaaaatgaaattttaatcatcgataaaatgcgaggcaaagagagttttgaaaat
ggaaatttgcaatgcttaggacattttaaaaatttgcttgaatttaaaggagagcttttt
atcggcgatattttagacgaaaagaccttaagaataatgcgtgaatttaagcccgaagtc
atctttcatcaagcggctatttcggacaccactgcaaacaatcaaaaccaaattttaaat
gtgaatctcaattcctttaaggatttaatcaaactaagcatagagcttaatgccaaactc
atttatgcaagttctgcttcagtttatggagacgcaaaaagccctcaaagcgtcggtttt
ggtgaaaaacctaagaatgtttatgctttttcaaaactgatgatggaaaatcttgctaca
aaattttacgataaagcccatttagtaggacttagatattttaatgtttatggaaaaggc
gaattttttaagggtaaaacttcaagtatgattttacaatttgctcatcaaattttaagt
gcaaaggctccgcgtttatttgagggaagcgataaaatttatagggattttgtttatatt
aaagatgttataaatgcaaatttagcagccctaaacgcaaaatccggagtgtataatgta
ggaagcggggttgcaaggacttttaaagaagttgcagacatcttgcaaaaagaattaggc
acaaattacagctatgaaatcataccaaacccttataaaaacgcttatcaataccacaca
caagcaaaactagaacaaaacttcgcttacactccgcaatttagtcttgaagagggcata
aaagactatttaagcgagataaaaagactatttgaagaagaaagcaaagcccatgtttaa

DBGET integrated database retrieval system