KEGG   Campylobacter cuniculorum: CCUN_0787Help
Entry
CCUN_0787         CDS       T05046                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ccun  Campylobacter cuniculorum
Pathway
ccun00430  Taurine and hypotaurine metabolism
ccun00620  Pyruvate metabolism
ccun00640  Propanoate metabolism
ccun00680  Methane metabolism
ccun01100  Metabolic pathways
ccun01120  Microbial metabolism in diverse environments
ccun01200  Carbon metabolism
Module
ccun_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ccun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCUN_0787 (ackA)
   00640 Propanoate metabolism
    CCUN_0787 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    CCUN_0787 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CCUN_0787 (ackA)
Enzymes [BR:ccun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CCUN_0787 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ARJ56404
UniProt: A0A1W6BWE3
Position
complement(782368..783552)
Genome map
AA seq 394 aa AA seqDB search
MKILVLNSGSSSIKFKLFENQKAVCSGLVEKIGNHQSKIELKILKTGTKMRRDTHIGDHE
KGLKLVNELFEESGILKDLNELDGCGHRIVHGGKNLTEHCLVNDFVLEEIHRVSSIAPLH
NPAHLAGIKTMMKAAPKVPNATIFDTAFHKTIPDYAYMYALPYDYYTEYNIRKYGFHGTS
HSYVSQRVAKLMGKKNEEINAISAHLGNGASVCAIENGKSIDTSMGFTPLEGLIMGTRCG
DIDPATIPFIAKAKDLNPDKLDTMMNKQSGLYGICGYNDFRDIISEIQNGNNLARLAFEM
YCYRLAKYIGSYFAILPYTDALIFTAGVGENAAAVRKLTCEKLKHLGIEIDEQLNEENSS
GEKEISTKNSKTKIFVIPTDEELEIAKITESLIS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttagtcttaaattctggttcatcgtcaattaaatttaaactttttgaaaat
caaaaggctgtttgtagtggtttggttgaaaaaatcggcaatcatcagtctaaaattgag
cttaaaatattaaaaaccggaactaaaatgagacgcgatactcatataggcgaccatgaa
aaaggacttaagcttgtcaatgagctttttgaagaatctggaattttaaaagacctcaat
gagcttgatggttgcggacatcgcattgtccatggaggtaaaaatttaacagagcattgt
ttggttaatgattttgtgcttgaagaaatccacagagtaagctccattgcacctttgcat
aatcctgcacatctagctgggattaaaacgatgatgaaagctgcaccaaaagtgcccaat
gcgacaatctttgatacagcttttcataaaaccatacctgattatgcttatatgtatgcc
ctgccctatgattattataccgaatacaatatccgcaaatatggttttcatggcacttct
cattcttatgtcagtcaaagagttgctaaacttatgggtaaaaaaaacgaagaaatcaac
gccatcagtgctcatcttggaaatggagcaagtgtttgtgccattgaaaatggaaaaagc
attgacacttcaatgggatttaccccattagaaggtcttataatggggacaagatgcgga
gatatagaccctgcaaccataccttttattgctaaggctaaggatttaaatccggataag
ctcgatacaatgatgaataagcaaagtggtttgtatggaatttgcggatacaatgatttt
agggatattatcagcgaaattcaaaatggaaacaatctcgcaagacttgcttttgaaatg
tattgttatcgtttggctaaatatataggttcttattttgcgattctgccttatactgat
gccttgatttttaccgctggagtgggagaaaatgctgctgcagtaagaaaattgacctgt
gaaaaactcaaacatcttggcatagaaattgatgaacaattaaacgaagaaaattcttct
ggtgaaaaagaaatcagcacaaaaaattctaaaacaaaaatttttgtcattcctacagat
gaagaattagaaatcgctaaaatcacagaaagcctcatctcttaa

DBGET integrated database retrieval system