KEGG   Campylobacter cuniculorum: CCUN_0900Help
Entry
CCUN_0900         CDS       T05046                                 

Gene name
ubiX
Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
ccun  Campylobacter cuniculorum
Pathway
ccun00130  Ubiquinone and other terpenoid-quinone biosynthesis
ccun01100  Metabolic pathways
ccun01110  Biosynthesis of secondary metabolites
ccun01120  Microbial metabolism in diverse environments
ccun01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ccun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CCUN_0900 (ubiX)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CCUN_0900 (ubiX)
Enzymes [BR:ccun01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     CCUN_0900 (ubiX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ARJ56510
UniProt: A0A1W6BWT9
Position
897889..898449
Genome map
AA seq 186 aa AA seqDB search
MKILLGISGSSSVHLGLKLLDNLEKKAKVFCIITEGAKISFEAENKKKLDKICKERFKKV
VFFEDNNLKAPVSSGSFGIKKTIIAPCSLSTLAKIHAGISDTLLTRACAVALKEQKKLIL
GVREMPFSFLNLKQMTKLSLQGVCIAPPIYASYSGVKNLEDLENFIVGKWLDLLKIKHNL
FKKWEG
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacttcttggaatttctggttcaagtagcgttcatttgggattaaaattgctt
gacaatttagaaaaaaaagctaaggttttttgcattattacagaaggagcaaaaatcagt
tttgaagctgaaaataaaaaaaaattagataaaatttgtaaagaacgttttaaaaaagtg
gttttttttgaagacaataaccttaaagctcccgtttctagtggttcttttggtataaaa
aaaaccatcattgcaccttgttctctttcaacccttgctaaaattcacgcaggaataagc
gataccttgcttacaagagcctgtgctgtggctttaaaagagcaaaaaaaactcatctta
ggagtgagagaaatgccttttagttttttaaatttaaaacaaatgacaaaattaagtctg
caaggcgtttgtatcgcacctcctatttatgcaagttatagcggggtaaaaaatttagaa
gatttagaaaattttatcgtgggaaaatggcttgacttacttaaaatcaaacataattta
tttaaaaaatgggagggataa

DBGET integrated database retrieval system