KEGG   Campylobacter cuniculorum: CCUN_0912Help
Entry
CCUN_0912         CDS       T05046                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ccun  Campylobacter cuniculorum
Pathway
ccun00010  Glycolysis / Gluconeogenesis
ccun00020  Citrate cycle (TCA cycle)
ccun00620  Pyruvate metabolism
ccun01100  Metabolic pathways
ccun01110  Biosynthesis of secondary metabolites
ccun01120  Microbial metabolism in diverse environments
ccun01130  Biosynthesis of antibiotics
ccun01200  Carbon metabolism
Module
ccun_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ccun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CCUN_0912 (pckA)
   00020 Citrate cycle (TCA cycle)
    CCUN_0912 (pckA)
   00620 Pyruvate metabolism
    CCUN_0912 (pckA)
Enzymes [BR:ccun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     CCUN_0912 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP PEPCK_GTP AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: ARJ56520
UniProt: A0A1W6BWU8
Position
909662..911236
Genome map
AA seq 524 aa AA seqDB search
MKNFEDLGLENVKQIFHNLSYDELFEHENKNKEGLCTANGTFSVDTGIFTGRSPKDKYFV
KQDPSQKYIAWGKINHPITKELFDKLLKKAKKELSGKNIYIQDAYCGASLKSKKAVRFVA
EIAWQAHFVKNMFIRPSKEELENFKPDFVVYNACKCVNDEYESDHLNSEVFVIFNIEENV
AVIGGTWYGGEMKKGIFSMMNYWLPLENKLSMHCSANVGEKGDVALFFGLSGTGKTTLST
DPKRKLIGDDEHGWDDDGVFNFEGGCYAKTINLDPKNEPEIYSAIKRNALLENVVLKENA
EVDYFDGSKTENTRVSYPIEHIENHEPSLKAGHPKNIIFLSADAFGILPPVSKLSKEQAM
YYFLSGYTAKVAGTERGITEPQATFSACFGEPFMPLHPTIYARLLGERIDKYNVNVYLVN
TGWSGGSYGVGKRMSIKATRACINAILDGSIQKCEFENFAVFDLAVPKTLEGVDSKLLNP
INTWENQEEYKHTRDKLAQMFIQNFKRYEDVKEGVEYSQFGPKF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattttgaagatttaggcttagaaaatgtaaaacaaatttttcataatctaagt
tacgatgagctctttgagcatgaaaacaaaaataaagaaggtctttgcactgcaaacgga
acttttagtgtggatacgggaattttcacaggaagaagtcctaaagataagtattttgtg
aagcaagatccttcacaaaaatacattgcttggggcaagattaatcatcctatcactaaa
gagctttttgataagcttttaaagaaagcaaaaaaagaattaagcggtaagaatatttat
attcaagatgcgtattgtggagcatctttaaagagtaaaaaagctgttcgttttgttgca
gagattgcttggcaagcccattttgtaaaaaatatgtttatacgtccaagcaaagaagag
cttgaaaatttcaaaccagattttgtggtttataatgcttgtaaatgtgttaatgatgaa
tatgaaagtgaccatttaaattctgaagtttttgtcatttttaatatagaggaaaatgtt
gcagtgattggtggaacttggtatggaggagagatgaaaaaaggaattttttctatgatg
aattattggttaccacttgaaaataagctttcaatgcattgtagtgcaaatgttggagaa
aaaggcgatgtggctttattttttgggttaagtggtacgggaaaaactacactttcaaca
gacccaaagaggaaacttatcggcgatgatgagcatggttgggatgatgatggggtgttt
aattttgaaggtggttgttatgcaaaaactatcaatttagacccgaaaaatgagcctgaa
atttattcagcgattaaaagaaacgctcttttggaaaatgttgttttaaaagaaaatgca
gaggttgattattttgatgggtcaaagactgaaaacacaagggtttcctatcctatagaa
cacattgaaaatcatgaaccaagcctaaaagccggacatcctaaaaatatcattttttta
agtgcagatgcttttggaattttacctcctgtgagtaagcttagtaaagaacaagcaatg
tattattttttaagtggttacacagctaaggttgcaggaactgaaagaggtattacagag
cctcaagcaactttttcagcttgttttggtgagccttttatgccacttcatccgacgatt
tatgcgagattgttaggtgaaaggattgataaatataatgttaatgtttatttggtcaat
accggttggagcggtggaagctatggagtgggtaagagaatgagcattaaagcaacgagg
gcttgtatcaatgcgattttagatggtagcatacaaaaatgcgaatttgaaaattttgct
gtgtttgatttggctgttcctaagactttagaaggagttgatagtaagcttttaaatcct
atcaatacttgggaaaatcaagaagaatataagcatacaagggataaattggcacaaatg
tttattcaaaatttcaaacgttatgaagatgtaaaagagggcgttgaatacagtcaattt
ggtcctaaattttga

DBGET integrated database retrieval system