KEGG   Campylobacter cuniculorum: CCUN_1435Help
Entry
CCUN_1435         CDS       T05046                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
ccun  Campylobacter cuniculorum
Pathway
ccun00230  Purine metabolism
ccun00250  Alanine, aspartate and glutamate metabolism
ccun01100  Metabolic pathways
Module
ccun_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ccun00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CCUN_1435 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCUN_1435 (purA)
Enzymes [BR:ccun01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CCUN_1435 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ARJ57023
UniProt: A0A1W6BY59
Position
complement(1463977..1465227)
Genome map
AA seq 416 aa AA seqDB search
MGKADIVVGVQWGDEGKGKIVDKLCENYDFVCRSAGGHNAGHTICVNHTRYALHLIPSGV
LNPLCINLIGNGVVVSPEILIAEMGQFDNLKGRLYISDRAHLNLRHHSLIDIAKEKLKGK
NAIGTTGKGIGPSYADKINRTGHRVCELLDPQRLCESLMKDFEINRTFLEILQIEIPKKE
ELLDDLNRYNKILAPFITNTTNLLWKALDEDKKVLLEGAQGSMLDIDHGTYPYVTSSNTI
AAGALTGLGLNPKEIGSIIGIVKAYTTRVGNGVFPTEDKGDDGERIAQIGKEIGVSTGRK
RRCGWFDAVAVRYAARLNGLDFLALTKLDVLDGFEKIKICRAYEYNGVEIDYMPSDLENV
KPIYEEFQGWDKVSELRDFDLLPSNAKLYIKRLEELVGVKIKIISTSAERDDTIIL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagcggatattgtcgtaggcgttcaatggggcgatgagggcaaaggcaagatt
gttgataaattatgcgaaaattatgattttgtttgtagaagtgcaggaggacataacgca
ggacatacaatttgtgtcaatcatacacgttatgcacttcatcttatcccttcgggtgtg
ttaaatccactttgtattaatcttatcggcaatggcgttgtagtatcacccgaaattctc
atcgctgaaatgggacaatttgacaatttaaaaggaagattatacatcagtgatagagcc
catcttaatttaagacatcattctttaatcgatatagccaaagaaaaactcaagggcaaa
aatgctataggcacgaccggaaaaggcataggaccaagttatgctgataaaattaaccgc
acaggacatcgagtctgtgagcttttagacccgcaaaggctttgtgaatctttaatgaaa
gattttgaaatcaatcggacttttttagaaattttgcagatagaaattccaaaaaaagaa
gaattgcttgatgatttaaatcgttacaataaaatcttagcacctttcatcacaaacacg
acaaatttactttggaaagccttagatgaggataaaaaagtgctcttagaaggtgctcaa
ggttcaatgctcgatatagaccatggcacttatccctatgtaacgagttcaaacacgatt
gcagcaggagccttaacaggactaggactcaatcctaaagaaataggttctatcataggc
atagttaaggcttacacaacaagggtgggaaatggagtttttcccactgaagacaagggc
gacgatggagaaagaatcgcacaaattggtaaagaaatcggcgtaagcacaggtcgcaaa
agacgttgtgggtggtttgatgccgttgcggtgcgttatgctgcaagactcaacgggctt
gattttttagccttgaccaaactcgatgttttagatggttttgaaaaaataaaaatttgc
agagcctatgagtataacggagtagaaattgactatatgccaagtgatttggagaatgta
aagcctatttatgaggaatttcaaggttgggacaaggtttctgagcttagggattttgat
ttattgccttcaaatgcaaagctttatattaagcgtttagaagagcttgtgggagtaaag
attaagattatttcaacaagtgcggaaagagatgataccattatactatga

DBGET integrated database retrieval system