KEGG   Cupriavidus sp. USMAHM13: BKK81_05605Help
Entry
BKK81_05605       CDS       T04762                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup00970  Aminoacyl-tRNA biosynthesis
ccup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BKK81_05605
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ccup03029]
    BKK81_05605
Enzymes [BR:ccup01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BKK81_05605
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BKK81_05605
Mitochondrial biogenesis [BR:ccup03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BKK81_05605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AOY98810
Position
1:complement(1258547..1259968)
Genome map
AA seq 473 aa AA seqDB search
MHEDPCLLPATVLRERIARRELSPVELTEAVLARAARLQPELNCFITLCAEQAMEAARAA
EQAQMAGRATGLLHGIPFTVKDIVNTQGVRTTFGALPHQHNVPAQDAVSVARLRAQGAIL
IGKTTTPEFGSKCLTDSPLFGRTRNAWSAARTCGGSSGGAAVAVASGIAPLAVATDGGGS
TRIPAACNGVVGIKQSQGVIPHSQAQDLFGNQTYVTPTTRTVADTGLMMQVMAGEHECDP
WSIGVPKPDYLEAAQARGDLRGRRVLYCLAPPGRPVAADVARAFEASLHRLETLGAELEP
FSGAGFDVEPIWRAINHTVWRTRFAPIVAAHGDQLSDTFKRQIESAAAFSGVQYQQAMFE
RSALFLRVQALLQRADLLAMPTLTRTALPLDQDLFGTIDIDGQSLENVRAHWFPWTMPFN
MTGHPAISLPCGFGDDGLPVGLQLVGRFRQDAMLLRAAALFESTHDLLARWPG
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaggatccctgcctcttgcccgccaccgtgctgcgcgagcgcatcgcgcgccgc
gaactgtcgccggtggagctgaccgaagccgtgctggcgcgagccgcccggctccagccc
gaactgaactgcttcatcaccttgtgcgccgagcaggccatggaggccgcgcgcgccgcc
gagcaggcgcagatggcgggccgggcgacggggctgctgcacggcattcccttcaccgtc
aaggacatcgtcaacacgcagggggtgcgcaccaccttcggcgcgctgcctcaccagcac
aatgtgccggcgcaggacgcggtctcggtggcgcgcctgcgcgcgcagggcgctatcctg
atcggcaagaccaccacgcccgagttcggctccaagtgcctgaccgattcgccgctgttc
ggccgcacccgcaacgcctggagcgccgcgcgcacctgcggcggctccagcggcggtgcc
gcggtggcggtggcgagcggcatcgcgccgctggcggtcgccaccgacggcggcggctcg
acgcgcatcccggccgcctgcaacggcgtggtcggcatcaagcaaagccagggcgtgatc
ccgcacagccaggcccaggacctgttcggcaaccagacctatgtcacgccgaccacccgc
accgtggccgacaccggcctgatgatgcaggtcatggctggcgagcacgagtgcgatccc
tggtcgatcggcgtgcccaagcccgactatctcgaggccgcgcaggcgcgcggcgacctg
cgcggccgccgcgtgctgtactgcctggcgccgcccggacgcccggtggcggccgatgtg
gcacgcgccttcgaggccagcctgcaccgcctggagacgctcggcgccgagctggagccg
ttctccggtgcgggcttcgacgtcgagccgatctggcgcgccatcaaccacacggtctgg
cgtacgcgcttcgcccccatcgtggcggcccacggcgaccagctcagcgacaccttcaag
cgccagatcgaatcggcggcggccttcagcggcgtgcaataccagcaggccatgttcgag
cgctcggccctgttcctgcgcgtgcaggccctgctgcagcgcgccgacctgctggccatg
cccacgctgacgcgcaccgcgctgccgctcgaccaggacctgttcggcaccatcgatatc
gacgggcagtcgctggagaacgtgcgcgcgcactggttcccctggaccatgcccttcaac
atgaccggccaccccgccatcagcctgccctgcggcttcggcgacgacggcctgccggtc
ggcctgcagctggtcggccgcttccgccaggacgcgatgctgctgcgcgccgccgccctg
ttcgaatcgacccacgacctgctggcgcgctggcccggctga

DBGET integrated database retrieval system