KEGG   Cupriavidus sp. USMAHM13: BKK81_09160Help
Entry
BKK81_09160       CDS       T04762                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup00350  Tyrosine metabolism
ccup00643  Styrene degradation
ccup01100  Metabolic pathways
ccup01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BKK81_09160
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    BKK81_09160
Enzymes [BR:ccup01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     BKK81_09160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: AOY99414
Position
1:2073725..2074375
Genome map
AA seq 216 aa AA seqDB search
MQLYSFFNSSTSYRVRIALRLKGVEHEYLGVNIRTGGHRDKQYVNQVNPSASVPAIVDGD
FHLGQSLAIIDWLDARYPEPRLLPADAGLRARVLELSTLIGCDIHPVNNLRILKYLQDVL
KVTPEQKDAWYRHWIAEGMAGVERLLAQAAEAYGGPWCFGAQPTLADCCLVPQIANALRM
GCDLDAFPRSLAVYRHASEHPAFAAAEPRRQPDYTA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgcagctttacagcttcttcaacagttcgacctcgtaccgcgtgcgcatcgcgctgcgg
ctcaagggcgtcgaacacgagtatctgggcgtcaacatccgcacgggcggacatcgtgac
aagcagtatgtgaaccaggtcaacccctccgcctcggtgcctgccatcgtggacggcgat
ttccacctggggcagtcgctggcgatcatcgactggctggacgcgcgctatcccgagccg
cgcctgctcccggccgacgccggcctgcgggcgcgcgtgctggagctgtccaccctgatc
ggctgcgatatccatccggtcaacaacctgcgtatcctgaagtacctgcaggacgtgctg
aaggtcacgccggagcagaaggacgcctggtaccggcactggatcgccgagggcatggcc
ggcgtcgagcgcctgctggcgcaggctgccgaagcctacggcgggccgtggtgcttcggc
gcgcagcccacgctggcggactgctgcctggtgccgcagatcgccaatgccctgcgcatg
ggctgcgacctggacgccttcccacgcagcctcgcggtgtaccgccacgccagcgagcat
cccgccttcgccgcggccgaaccccggcgccagcccgactacacggcatga

DBGET integrated database retrieval system