KEGG   Cupriavidus sp. USMAHM13: BKK81_14465Help
Entry
BKK81_14465       CDS       T04762                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup00471  D-Glutamine and D-glutamate metabolism
ccup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BKK81_14465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccup01011]
    BKK81_14465
Enzymes [BR:ccup01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BKK81_14465
Peptidoglycan biosynthesis and degradation proteins [BR:ccup01011]
 Precursor biosynthesis
  Racemase
   BKK81_14465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race His_Phos_1 EccE
Motif
Other DBs
NCBI-ProteinID: AOZ00308
Position
1:3293951..3294796
Genome map
AA seq 281 aa AA seqDB search
MNQPANDAPIGIFDSGLGGLSVLREIRALLPHESLLYIADSKYAPYGEKPERFVEARTLQ
VCRWLADQGCKALVIACNTATVHAVQTLRETLPLPIIGVEPGLKPAAAASRSKVVGVLAT
ANTLKGAKFARLLASLDGESRFLCTAGIGLVDAIERGDVGSAAVRASLAGFLQPMLDAGA
DTLVLGCTHYPFLTDTLVEMIGGRMALIDTGAAVARQLARRLAEHGIAAAPGAAPFTRYA
TTKEASHLQDMVAALLHVDAQAETIVIEPAPPLDAAAHVLR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccagcccgccaacgacgctcccatcggcatcttcgattccggcctcggcggcctg
tcggtcctgcgcgagatccgcgcgctgctgccgcacgaatcgctgctgtatatcgccgat
tcgaagtacgccccctatggcgagaagccggagcgcttcgtcgaggcgcgcacgctgcag
gtctgccgctggctggccgaccaaggctgcaaggcgctggtgatcgcctgcaataccgcc
accgtccatgccgtgcagacgctgcgcgagacgctgccgctacccatcatcggggtagag
cccggcctgaagccggccgccgccgccagccgcagcaaggtggtgggcgtgctcgccacg
gccaatacgctcaagggcgcgaagttcgcgcgcctgctggcttcgctcgacggcgagagc
cgcttcctctgcaccgccggcatcggcctggtggacgcaatcgagcgcggcgacgtcggc
agcgcggcggtgcgcgccagcctggccggcttcctgcagcccatgctggacgccggcgcc
gacacgctggtactgggctgcacccactaccccttcctgacggacacgctggtggagatg
atcggcggacgcatggcgctgatcgataccggcgccgcggtcgcgcgtcagctcgcgcgc
cggctggccgagcacggcatcgccgccgcgcccggcgcggcccccttcacgcgctatgca
acgaccaaggaagccagccacctgcaggatatggtcgccgccctgctgcacgtcgacgcg
caggcggaaacgatcgtcatcgaaccggcgccgccgctggacgcggcggcacatgtcctg
cgctga

DBGET integrated database retrieval system