KEGG   Cupriavidus sp. USMAHM13: BKK81_17280Help
Entry
BKK81_17280       CDS       T04762                                 

Definition
(GenBank) carbohydrate kinase family protein
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup00230  Purine metabolism
ccup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BKK81_17280
Enzymes [BR:ccup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     BKK81_17280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AOZ00805
Position
1:3905337..3906284
Genome map
AA seq 315 aa AA seqDB search
MASLICGSVAYDTIMTFEGRFREHILPDQIHMLNVSFLVPGMRREFGGCAGNIAYTLKLL
GGDPLVMATVGADAEPYLQYLRQLGIPTTYIRTLPDTFTAQAMITTDLDNNQITAFHPGA
MSQSQLSSVQEAMQGDTRPALGIVAPDSREGMLHHARQFAEADVPFIFDLGQAMPLFNGD
DLRQFVELASYVTVNDYEAQVLLSRTGWSHEDVAAQVRAFIVTHGEHGASIHADGRKYAI
PAVPAERVVDPTGCGDAFRGGLLYGIEHGLDWETTGRLASLMGSLKIAHQGPQNHKPSRD
EIRDRFQAAFGFHYA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggccagcctgatttgcggctccgttgcctacgacaccatcatgaccttcgaaggacgg
ttccgcgaacacatccttccggaccagatccacatgctcaacgtatccttcctggtcccg
ggcatgcgtcgtgagttcggaggctgcgcgggcaacatcgcctacacgctcaagctgctg
ggcggcgatccactggtgatggccacggtgggcgccgacgccgagccctatctgcagtac
ctgcgccagctgggcatccccaccacctatatccgcacgttgcccgacaccttcacggcc
caggcaatgatcacgaccgacctggacaacaaccagatcacggccttccacccgggtgcg
atgagccagtcgcaactgtccagcgtgcaggaagcgatgcagggcgacacgcggccggcg
ctggggatcgtcgcgccggacagccgcgagggcatgctgcaccatgcccgccagttcgcc
gaagcggacgtgcctttcatcttcgacctgggccaggccatgccgctgttcaacggcgac
gacctgcgccagttcgttgaactcgccagttacgtgacggtcaatgactacgaggcgcag
gtcctgctctcccgcaccggctggagccacgaggatgtcgccgcccaggtgcgcgcgttc
atcgtcacgcacggcgagcacggtgccagcatccatgccgacgggcgcaagtatgcgatc
cccgccgtgccggcagaacgtgtggtcgaccccaccggctgcggcgacgcgttccgcggc
ggcctgctgtacggcatcgaacacggcctcgactgggaaaccacggggcgcctcgccagc
ctgatgggctcgctcaagatcgcgcatcagggaccacagaaccacaagccatcgcgtgac
gaaatccgtgaccgtttccaggcggccttcggattccactacgcgtag

DBGET integrated database retrieval system