KEGG   Cupriavidus sp. USMAHM13: BKK81_17585Help
Entry
BKK81_17585       CDS       T04762                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup00471  D-Glutamine and D-glutamate metabolism
ccup00550  Peptidoglycan biosynthesis
ccup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BKK81_17585
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BKK81_17585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccup01011]
    BKK81_17585
Enzymes [BR:ccup01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     BKK81_17585
Peptidoglycan biosynthesis and degradation proteins [BR:ccup01011]
 Precursor biosynthesis
  Amino acid ligase
   BKK81_17585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AOZ00861
Position
1:complement(3971455..3972963)
Genome map
AA seq 502 aa AA seqDB search
MFGELQQPHVLVLGLGESGLAMARWCGRHGCAVRVADTREAPANLVFLQAELTGAEFVGG
AFGETLLDGIGLVAISPGLSPNEAGTAALLAAARARGIPVWGEIELFARALVQLQADTGY
TPSVIAITGTNGKTTTTALTGRLAERAGKSVAVAGNISPSALDKLAACIAAGALPEVWVL
ELSSFQLETTHTLAPHAATVLNVTQDHLDWHGSMEAYAAAKARIFGTSGHCVQVLNRNDR
VTMAMARPGSVPVSFGTDLPETAGSYGILREGGMPWLVLAEADSEAEESRPRRRKSAAGA
PEEALPVRHKRLMPVDALQIRGLHNATNAMAALALCRAIGLPLNALLHGLREYQGEPHRV
EHMMTLDEVEYFDDSKGTNVGATVAALSGLDKRVVLIAGGEGKGQDFSPLAAPVAQYARA
VVLIGRAAGELRAALEESGAQLVDAGTLEEAVTLAARLAQPGDAVLLSPACASLDMFRNY
VHRAEVFRAAVEELALSRGIMP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgttcggcgagttgcaacaacctcatgtgctggtactgggcctgggcgaatcgggcctg
gcgatggcgcgctggtgcggccgccacggctgcgccgtgcgcgtggccgacacgcgcgag
gcgcccgccaaccttgtcttcctgcaagccgagctgaccggcgccgagttcgtcggtggc
gctttcggcgagacgctgctcgacggcatcggcctggtggcgatcagccccggcctgtcg
ccgaacgaggccggcacggccgctctgctggcggcggcgcgcgcgcgcggcatcccggtg
tggggcgagatcgagctgttcgcccgcgccctggtgcagttgcaggccgacaccggctat
accccgagcgtgatcgccatcaccggcaccaacggcaagaccaccaccaccgcgctgacc
ggccgtctggccgagcgcgccggcaagagcgtggccgtggccggcaatatcagtccttcc
gcgctcgacaagctggccgcctgcatcgccgccggggcgctgcccgaagtctgggtgctg
gagctctccagcttccagctcgagaccacccacacgctggcgccgcacgcggccaccgtg
ctcaacgtgacgcaggaccacctcgactggcacggcagcatggaggcctatgccgccgcc
aaggcccgcatcttcggcacctcgggacattgcgtgcaggtgctgaaccgcaatgaccgc
gtgaccatggcgatggcacggcccggctcggtgccggtcagcttcggcaccgacctgccc
gagacggccggcagctacggcatcctgcgcgagggcggcatgccctggctggtgctggcg
gaggccgacagcgaggccgaggagtccaggccgcgtcgccgcaagtccgccgcgggcgcg
ccggaggaggcgctgccggtgcgccacaagcgcctgatgcccgtggacgcgctgcagatc
cgcggcctgcacaatgccaccaatgcgatggccgcgctggcactgtgccgcgccatcggc
ctgccgctcaatgccctgctgcacgggctgcgcgagtaccagggcgaaccgcatcgtgtc
gagcacatgatgacgctggacgaagtcgagtacttcgacgacagcaagggcaccaatgtc
ggcgccaccgtggccgccttgtccgggctggacaagcgcgtggtgctgatcgcgggcggc
gagggcaaggggcaggatttctcgccgctggcggcgccggtcgcgcagtacgcgcgtgcg
gtggtgctgatcgggcgcgccgccggtgaattgcgcgcggcgctggaggagagcggcgcg
cagctggtcgacgccggcacgctggaagaggcggtcacgctggccgcgcgcctggcccag
ccgggcgacgccgtgctgctgtcgcccgcctgtgccagcctcgacatgttccgcaactac
gtgcaccgcgccgaggtgttccgcgctgcggtggaggaactcgccctgtcccgggggatc
atgccatga

DBGET integrated database retrieval system