KEGG   Cupriavidus sp. USMAHM13: BKK81_18560Help
Entry
BKK81_18560       CDS       T04762                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup00071  Fatty acid degradation
ccup00072  Synthesis and degradation of ketone bodies
ccup00280  Valine, leucine and isoleucine degradation
ccup00310  Lysine degradation
ccup00362  Benzoate degradation
ccup00380  Tryptophan metabolism
ccup00620  Pyruvate metabolism
ccup00630  Glyoxylate and dicarboxylate metabolism
ccup00640  Propanoate metabolism
ccup00650  Butanoate metabolism
ccup00900  Terpenoid backbone biosynthesis
ccup01100  Metabolic pathways
ccup01110  Biosynthesis of secondary metabolites
ccup01120  Microbial metabolism in diverse environments
ccup01130  Biosynthesis of antibiotics
ccup01200  Carbon metabolism
ccup01212  Fatty acid metabolism
ccup02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BKK81_18560
   00630 Glyoxylate and dicarboxylate metabolism
    BKK81_18560
   00640 Propanoate metabolism
    BKK81_18560
   00650 Butanoate metabolism
    BKK81_18560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BKK81_18560
   00072 Synthesis and degradation of ketone bodies
    BKK81_18560
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BKK81_18560
   00310 Lysine degradation
    BKK81_18560
   00380 Tryptophan metabolism
    BKK81_18560
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BKK81_18560
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BKK81_18560
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BKK81_18560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccup04147]
    BKK81_18560
Enzymes [BR:ccup01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BKK81_18560
Exosome [BR:ccup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BKK81_18560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOZ01429
Position
2:complement(10448..11626)
Genome map
AA seq 392 aa AA seqDB search
MAEAYIVAAVRTAGGRKGGKLSGWHPADLAAQVLDALVERTGADPALIEDVIMGCVGQAG
EQSGNIARNAVLASRLPESVPGTSVDRQCGSSQQALHFAAQAVMSGTMDIVIAAGVESMT
RVPMGLPSTLPAQNGFGSSMSPNMQQRYPGVKFSQFTGAEMMARKYELQRADLDRYALQS
HQRAIAATQAGVFAAEIVPVAVRLPDGSTNGELHTVDEGIRFDATLESIGSVKLIAEGGR
VTAATASQICDGAAGLMVVNEAGLKKLGVKPLARVHHMTMLGHDPVIMLEAPVPATLHAL
KRAGMKIDEIDLFEVNEAFAPVPLAWLKTTGADPDRLNVNGGAIALGHPLGGSGAKLMTT
LVHALHQRGKRYGLQTMCEGGGMANVTIVERL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcatacatcgttgccgcggtgcgcaccgcgggaggacgcaagggcggcaag
ctgtccggctggcatccggccgacctggcggcgcaggtgctggacgcgctggtcgagcgc
accggcgccgacccggccttgatcgaggacgtgatcatgggctgcgtcggccaggccggc
gagcagtcgggcaatatcgcgcgcaatgcggtgctggcctcgcgcctgccggagagcgtg
cccggcacttcggtggaccgccagtgcggctcctcccagcaggccctgcacttcgccgcg
caggcggtgatgtcgggcaccatggacatcgtcatcgccgccggcgtggagagcatgacg
cgcgtgccgatggggctgccgtcgacgctgccggcgcagaacggcttcggcagctcgatg
agccccaacatgcagcagcgctatcccggcgtgaagttcagccagttcaccggcgccgag
atgatggcgcgcaagtatgagctgcagcgcgcggacctggaccgctatgcgctgcagagc
caccagcgcgccatcgccgccacccaggccggtgtgtttgccgcggagatcgtgccggtg
gccgtgcgcctgcccgacggcagcaccaacggcgagctgcataccgtggacgagggcatc
cgcttcgatgcgacgctggagtcgatcggcagcgtcaagctgatcgccgaaggcgggcgc
gtcaccgccgccaccgccagccagatctgcgacggcgcggccggcctgatggtggtcaac
gaagcgggcctgaagaagctgggcgtcaagccactggcgcgcgtgcatcacatgaccatg
ctgggccacgacccggtcatcatgctggaggcgccggtgccggccacgctgcacgcgctc
aagcgcgccggcatgaagatcgacgagatcgacctgttcgaggtcaacgaggccttcgcc
ccggtgccgctggcctggctcaagaccaccggcgccgatccggaccggctcaacgtcaac
ggcggcgcgatcgccctaggccatccgctgggcggctcgggcgccaagctgatgaccacg
ctggtgcacgcgctgcaccagcgcggcaagcgctacggcctgcagaccatgtgcgagggc
ggcggcatggccaacgtgaccatcgtcgagcggctgtga

DBGET integrated database retrieval system