KEGG   Cupriavidus sp. USMAHM13: BKK81_18955Help
Entry
BKK81_18955       CDS       T04762                                 

Definition
(GenBank) acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup00290  Valine, leucine and isoleucine biosynthesis
ccup00650  Butanoate metabolism
ccup00660  C5-Branched dibasic acid metabolism
ccup00770  Pantothenate and CoA biosynthesis
ccup01100  Metabolic pathways
ccup01110  Biosynthesis of secondary metabolites
ccup01130  Biosynthesis of antibiotics
ccup01210  2-Oxocarboxylic acid metabolism
ccup01230  Biosynthesis of amino acids
Module
ccup_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ccup_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BKK81_18955
   00660 C5-Branched dibasic acid metabolism
    BKK81_18955
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BKK81_18955
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BKK81_18955
Enzymes [BR:ccup01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     BKK81_18955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: AOZ03785
Position
2:complement(106134..107672)
Genome map
AA seq 512 aa AA seqDB search
MNGAESLVKTLLASGVDTCFANPGTSEMHFVAALDRIPGMRCVLGLFEGVVTGAADGYAR
MADKPAATLLHCGPGLANGLANLHNARRANTPVVNIVGDQATYHRPLDAPLTADTEGWAR
PVSVWTRTATRAASVGADAAAAVQAARGAPGGVATLVLPSDVCWDAGGRVAAPLPDLPVP
KVSPDAVQQAARVLRSGQPTLIVLAGAALREAALADAHRIAAATDARLITPMSNARVARG
RGRLAVERIPYSGEAARTRLAGIRNVILVGAPPPVTFFAYPGQSPRPYPEDAVIHVLARP
EEDLGEALARLADELGAPKVQPSAGGPRAEIARGAVTSEAVAQTLTALLPEQAVVVEESV
SFGRAFYPGTVHAAPHDWLQLTGGAIGDGLPLATGAAVAVPGRRVVALQADGSGMYTLQS
LWTMARERLDVTVVVLANRKYAILLGELAGVGANPGKTALDMLDLGNPDLDWVKLANGMG
VEAARAADMESFADLFRSANQRKGPFLIELVI
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcgccgaaagcctggtcaagaccctgctggccagcggcgtcgacacctgcttc
gccaaccccggcaccagcgagatgcactttgtcgccgcgctcgaccgcattcccggcatg
cgctgcgtgctcggcctgttcgagggcgtggtcaccggcgccgccgacggctacgcgcgc
atggccgacaagccggcggcgacgctgctgcactgcggccccggcctggccaacggtctc
gccaacctgcacaacgcgcgccgggccaacacgccggtggtcaatatcgtcggcgaccag
gccacctatcaccgtccgctcgatgcgccgctgaccgccgataccgaaggctgggcgcgc
ccggtctcggtctggacccgcaccgccacccgcgccgcctcggtcggcgccgacgctgcc
gccgcggtgcaggccgcgcgtggcgcgccgggcggcgtggccacgctggtgctgccctcc
gacgtgtgctgggacgccggtggccgcgtggccgccccgctgcccgacctgccggtgccc
aaggtctcgcccgatgccgtgcagcaggccgcgcgcgtgctgcgttcgggccagcccacg
ctgatcgtgctcgccggcgcggcgctgcgcgaggccgcgctggccgatgcgcaccgcatc
gccgccgccaccgacgcgcgcctgatcacgccgatgtcgaacgcgcgcgtggcgcgcggg
cgcggccgtctcgccgtcgagcgcattccctattcgggcgaggcggcgcgcaccaggctg
gccggcatccgcaacgtgatcctggtcggcgcgccgccgcccgtgaccttctttgcctat
cccggccagtcgccgcgcccttatcccgaggatgcggtcatccacgtgctggcgcgtccc
gaggaagacctcggcgaagccctggcgcggctggcggatgagctcggcgcgcccaaggtg
cagccgtcggccggtggcccgcgcgcggagatcgcgcgcggcgcggtgacctcggaggcg
gtggcgcagacgctgaccgcgctgctgcccgaacaggcggtggtggtggaggagagcgtc
agcttcggccgtgccttctatcccggcaccgtgcacgcggccccgcacgactggctgcaa
ctcaccggtggcgccatcggcgacggcctgccgctggccaccggcgccgccgtggccgtg
cccggacggcgcgtggtggcgctgcaggcggacggctccggcatgtacacgctgcagtcg
ctgtggaccatggcgcgcgagcggctcgacgtcaccgtggtggtgctggccaaccgcaag
tacgccatcctgctgggtgagctggccggcgtcggcgccaaccccggcaagaccgcgctc
gacatgctggacctgggcaatcctgacctcgactgggtcaagctggccaacggcatgggc
gtggaagccgcgcgcgcggccgacatggagagcttcgccgacctgttccgctcggccaac
cagcgcaagggcccgttcctgatcgaactggtgatctga

DBGET integrated database retrieval system