KEGG   Cupriavidus sp. USMAHM13: BKK81_31740Help
Entry
BKK81_31740       CDS       T04762                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ccup  Cupriavidus sp. USMAHM13
Pathway
ccup00020  Citrate cycle (TCA cycle)
ccup00480  Glutathione metabolism
ccup01100  Metabolic pathways
ccup01110  Biosynthesis of secondary metabolites
ccup01120  Microbial metabolism in diverse environments
ccup01130  Biosynthesis of antibiotics
ccup01200  Carbon metabolism
ccup01210  2-Oxocarboxylic acid metabolism
ccup01230  Biosynthesis of amino acids
Module
ccup_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ccup_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ccup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BKK81_31740
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BKK81_31740
Enzymes [BR:ccup01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BKK81_31740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AOZ03598
Position
2:complement(3085748..3087985)
Genome map
AA seq 745 aa AA seqDB search
MSDQQPTIIYTLTDEAPLLATSAFLPIIRTFTAPAGINVATSDISLAGRILGEFPELLTE
EQRVPDNLAELGRMTLLPDTNIIKLPNISASVAQLKAAVKELQGKGYQLPDVPDEPKNDE
EKALKARYSKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHSMGEWKQWSRTHVSHMEH
GDFYHGEKSLTLDRARDVKMELVTKSGKAIVLKPKVALLNGEIIDSMFMSKKALCEFYEQ
QLEDCRQAGILFSLHVKATMMKVSHPIVFGHCVKIYYKEAFEKHGKLFDELGINVNNGMV
DLYEKIKTLPESKHEEIIRDLHACQEHRPALAMVDSAKGITNFHSPNDVIVDASMPAMIR
QGGKMWGADGKPYDCKAVMPESTFARIYQEMISFCKWHGNFDPRTMGTVPNVGLMAQKAE
EYGSHDKTFEIPEDGVANITDLATGEVLLSQNVEAGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAVFWLDSYRPHENELIKKVEAYLKDHDTSGLDIQIMSQVRAMRYTLERVARGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALAVSLEELGIKNDNARAKILAKTLDEATGKLLDLNKSPSRRTGELDNR
GSQFYLAMYWAQALAAQTEDAELAAKFAELAKTLTANEKTIVGELSDVQGKPADIGGYYM
PDAAKLEGVMRPSKTLNNALAAVSA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccagcaaccgaccatcatttacacgctgaccgacgaagcacccttgctggcg
accagtgccttcctgccgatcatccgcaccttcacggcaccggccggcatcaacgtcgcc
accagcgacatctcgctggccggccgtatcctgggcgagttccccgaactcctgaccgaa
gagcagcgcgtccccgacaacctggccgaactcggccgcatgaccctgctgccggacacc
aacatcatcaagctgccgaacatcagcgcatcggtggcccagctgaaggccgcggtcaag
gaactgcagggcaagggctaccagctgccggacgtgccggacgagcccaagaacgacgaa
gagaaggcactcaaggcgcgctactcgaagtgcctgggctcggcggtgaacccggtcctg
cgcgaaggcaactccgaccgccgcgcgccggcggcggtgaagaactacgccaagaagcat
ccgcattcgatgggcgagtggaagcaatggtcgcgcacccatgtctcgcacatggagcac
ggtgacttctaccatggcgagaagtcgctgacgctggaccgcgcgcgcgatgtcaagatg
gagctggtcaccaagagcggcaaggccatcgtgctcaagccgaaggtcgccttgctgaac
ggcgagatcatcgactcgatgttcatgagcaagaaggcgctgtgcgagttctacgagcag
cagctcgaggactgccgccaggccggcatcctgttctcgctgcacgtcaaggcgaccatg
atgaaggtctcgcacccgatcgtgttcggccactgcgtcaagatctactacaaggaagcc
ttcgagaagcacggcaagctgttcgacgagctgggcatcaacgtcaacaacggcatggtc
gatctctacgagaagatcaagaccctgccggagtccaagcacgaagagatcatccgcgac
ctgcacgcctgccaggagcaccgcccggcgctggccatggtcgattcggccaagggcatc
accaacttccactcgcccaacgacgtgatcgtggatgcctccatgcccgcgatgatccgc
cagggcggcaagatgtggggcgccgacggcaagccctatgactgcaaggccgtgatgccc
gagtcgaccttcgcccgcatctaccaggagatgatcagcttctgcaagtggcacggcaac
ttcgacccgcgcacgatgggcacggtgccgaacgtcggcctgatggcgcagaaggccgag
gagtacggttcgcacgacaagaccttcgagatccccgaagacggcgtcgccaacatcacc
gacctggccaccggcgaagtgctgctgtcgcagaacgtcgaggcgggtgacatctggcgc
atgtgccaggtcaaggacgcgccgatccgcgactgggtcaagctggccgtcacgcgcgcg
cgcaactcgggcatgccggcggtgttctggctcgactcgtaccgtccgcatgagaacgag
ctgatcaagaaggtcgaagcctacctgaaggaccacgacaccagcggcctggatatccag
atcatgtcgcaggtgcgcgcgatgcgctacacgctggaacgcgtggcacgcggcctggac
accatctcggtgaccggcaacatcctgcgcgactacctgaccgacctgttcccgatcatg
gaactgggcaccagcgccaagatgctgtcgatcgtgccgctgatggccggtggcggcatg
tacgaaaccggcgccggcggttcggcgcccaagcacgtgcagcagctggtcgaggagaac
cacctgcgctgggattcgctgggcgagttcctggccctggcggtgtcgctggaagagctg
ggcatcaagaacgacaacgcccgcgccaagatcctggccaagaccctggacgaagccacc
ggcaagctgctggacctcaacaagtcgccgtcgcgccgcaccggtgagctggacaaccgt
ggcagccagttctacctggccatgtactgggcccaggcactggccgcgcagaccgaggac
gccgagctggcggccaagttcgccgagctggccaagacgctgaccgccaacgagaagacc
atcgtcggcgagctgtccgacgtgcagggcaagccggcggacatcggcggctactacatg
cccgatgccgccaagctggaaggcgtgatgcgccccagcaagacactgaacaacgcgctg
gcggccgtttcggcctga

DBGET integrated database retrieval system