KEGG   Campylobacter curvus: CCV52592_0010Help
Entry
CCV52592_0010     CDS       T00576                                 

Gene name
nosZ
Definition
(GenBank) nitrous oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
ccv  Campylobacter curvus
Pathway
ccv00910  Nitrogen metabolism
ccv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    CCV52592_0010 (nosZ)
Enzymes [BR:ccv01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     CCV52592_0010 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cupredoxin_1 Cytochrome_CBB3 COX2 DUF885
Motif
Other DBs
NCBI-ProteinID: EAU00338
UniProt: A7H0S2
Position
complement(1829983..1832574)
Genome map
AA seq 863 aa AA seqDB search
MQKFLNSCIAGIALLGLSFSAACSASDLEQVMKERGLSEKDVLAAAKTYQPSGRKDEFIV
FSSGGQSGQILVYGVPSMRIYKYIGVFTPEPWQGYGYDDESKAVLKQGAIRGKEITWGDT
HHPNFTEKNGEYVGDYLFINDKANPRIAVVNLHDFETTQIVVNPIMKSEHGGSFITPNSE
YVIEASQYAAPLDNNYHSIDDYEAVYRGAITFWKFDYPKGKIDEKASFSLELPPYWQDLS
DAGKGESFGWAFTNSINTEMYTGGIEKGLPPFEAGASRNDTDFMHVYNWQILEKLAKDKK
NYMEINGHRVITIKAAVDAGALFLIPESKSPHGIDVTPDGRYIIIGGKLDTHASVYDFRK
IKELIDKKDFAGTDPYGIPILDMKKALHGQVELGLGPLHNSFDSKDGIVYTSLYVDSQII
KWDYKNLKVLDKVNVHYNIGHLDTMEGKSSKPVGKYAIALDKLSIDRFNPVGPLHPQNHQ
LIDISGAKMDLIYDMPIPLGEPHDVVSIAASKLSPALTYNMGTNSRTGKPSPYVTLAGQE
RIERNGKNVTVFATMIRSHINPEHIEVNKGDNVTIHLTNLERAQDETHGFGIDLYNIHAS
LEPGKTASVNFVADMEGIFPYYCTEFCSALHLEMMGYLLVKDPNKKYESAKGNKLKALSP
EALKAEYDKVIATNKATDAVIQEVVAYLKEKHFEKYPKVKEQVEDALDQYSKIAEVKKKA
DEAYKKGDVNGAILWEYQVWQYMVKTADVGLRAKNNLAKAIATPMSAGAAKGEEAYLKGG
CNGCHVIGQVSSGPDLTGVLLRHENGEKWVADFIKDPAKFYENDYVKAMINYFNLRMPNQ
HMSDEEIKHIIEYLKWIDENAGL
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagtttttaaactcttgtatcgcgggtatcgcgctgcttgggttgtcttttagc
gcggcgtgtagcgcaagtgatcttgaacaggtcatgaaagagcgcggactcagcgagaaa
gacgtcctagcagccgccaaaacctatcagccaagcggacgaaaggacgaattcatcgta
ttttcatccggcggtcaatcaggccagatactagtttacggcgttccgtcgatgagaatt
tacaaatacatcggcgttttcacgcctgagccttggcaaggatacggctatgacgacgag
tcaaaggcagtgctaaaacaaggcgctatcaggggcaaagagataacctggggcgatacg
caccacccgaatttcaccgagaaaaacggcgaatacgtgggcgattatcttttcatcaac
gataaggccaaccctcgtatagccgtcgtaaatttacatgatttcgagaccactcagatc
gtcgtaaatccgataatgaaaagcgagcacggcggtagcttcatcactccaaacagcgaa
tacgtcatcgaagccagccaatacgcagctccgcttgataacaactaccactccatagac
gactacgaggcggtttatcgcggtgcgatcacgttttggaaattcgactatccaaagggc
aagatagacgaaaaggcctctttctcgcttgagctgcctccatactggcaagatctaagc
gacgctggtaagggagagagctttggctgggctttcacaaactcgataaataccgagatg
tatacaggcggtatcgaaaagggcttgcctccgtttgaggcgggtgctagtaggaacgat
accgacttcatgcacgtttataactggcaaattttagaaaagctagctaaggacaagaaa
aactatatggagataaacggccatagagtcatcaccattaaggctgccgtcgatgcggga
gcgctatttttgatacctgagtcaaaaagccctcacggtatagacgtgacgcctgatggc
agatacatcataatcggcggaaaactcgatactcacgcttccgtttatgactttagaaag
ataaaagagctcatagataaaaaggattttgccggtactgacccgtatggcattcctatc
ctcgatatgaaaaaagcccttcacggacaggtagaactaggccttggaccactgcacaac
tcttttgactctaaagacggcatagtctatacttcgctttatgtcgactctcagatcata
aaatgggactataaaaatttaaaggtgcttgataaggtaaatgtgcattataacatcgga
caccttgacactatggagggcaagtcctctaaaccggtaggcaaatacgccatagcgctg
gataagctttctatcgatcgcttcaatccggtaggacctcttcatccgcaaaatcaccag
ctcatcgacataagcggtgctaagatggatctaatctacgatatgcctatacctcttgga
gagcctcacgatgtcgtctctatcgcagcttccaagctaagtccggcgcttacttacaac
atgggaacaaactcaagaacaggcaagccaagcccttatgtcacccttgccggtcaagag
aggatcgagcgaaacggcaaaaatgtgaccgtgtttgcaacgatgataagaagccatatc
aaccctgagcatatcgaggtaaataagggagataacgttactatccaccttacaaactta
gagcgcgctcaagacgagactcacggctttggtatagatctatacaatatccacgcatcg
cttgagccgggcaaaacggcaagcgtaaatttcgtagccgatatggaaggcatcttccct
tactactgcacggaattttgctctgcgcttcaccttgagatgatgggatatttgctcgtt
aaagatccgaataaaaaatacgaatccgcaaaaggcaacaagctaaaagctctaagcccc
gaggctttaaaagccgagtatgacaaggtcatcgcgacaaacaaagccactgacgcggtc
atacaagaggtcgtagcgtatctgaaagaaaaacattttgaaaaatatccgaaggtaaaa
gagcaagtcgaggacgcactggatcaatacagcaagatagccgaagtcaagaaaaaagcc
gatgaggcctataaaaaaggcgacgtaaacggcgcgatcctttgggagtatcaagtatgg
caatacatggtaaaaaccgccgatgtgggtctaagggctaaaaacaatctcgcaaaagct
atcgcgactcctatgagtgcgggtgctgcaaagggcgaggaggcctatttaaaaggcgga
tgcaacggctgccacgtcatcggtcaagtaagctctggtcctgatctaacgggcgtgctt
ttgcgacacgagaacggcgagaaatgggtggctgatttcataaaagatcctgcgaaattt
tatgagaacgactatgttaaagcgatgataaattactttaacctaaggatgccaaatcag
cacatgagcgatgaggagataaagcatatcatcgaatacctaaaatggatcgatgagaac
gccggtctttaa

DBGET integrated database retrieval system