KEGG   Campylobacter curvus: CCV52592_0291Help
Entry
CCV52592_0291     CDS       T00576                                 

Definition
(GenBank) sugar transferase
  KO
K00996  undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6]
Organism
ccv  Campylobacter curvus
Brite
KEGG Orthology (KO) [BR:ccv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ccv01005]
    CCV52592_0291
Enzymes [BR:ccv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.6  undecaprenyl-phosphate galactose phosphotransferase
     CCV52592_0291
Lipopolysaccharide biosynthesis proteins [BR:ccv01005]
 O-antigen
  CCV52592_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf Globin
Motif
Other DBs
NCBI-ProteinID: EAU00049
UniProt: A7GZ27
Position
complement(1206396..1207706)
Genome map
AA seq 436 aa AA seqDB search
MKKYLSFLILLICDIFVISLCIALSVLIKNFIYGNGVFYDANRYVGLFLVQAIMIFLFIF
QGVYTRRYDFWHESYIIVRSCFLGLFLSLAILALIKINYEYSRTVFILSFIFMMFLLPIS
KFILKRQLFAIGIWQKRAKVIGKNTDFELEIFTNRYLGYVKETGGGYESLFITNEKLKPE
ILNELIEQNIIANKEILFAPMLQTYDFTKAHIYGFFNSRTNIFAIQNSLKSRSRMVMKRY
LDIVLIVLALPVLVPIFLIIMAMIKIKEPNAKIFFSHERMGRNGRLFGCLKFRSMRENSS
QILQEYLKANPQENEYFEKYHKYEHDPRITKFGNFIRKTSLDELPQLINVLKGEMSIVGP
RPCAQYEKKDMGKYADLILAVRPGITGIWQVSGRSNVDFETRAQMDAWYMKNWSIWNDIV
IIIKTFKVVLARKGAS
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatctatcttttttgattttgctgatttgtgacatctttgttatctcgctt
tgtattgctctttccgttttgattaaaaattttatctatggtaacggagttttttacgat
gccaataggtatgtcggtctttttttggtacaagcgatcatgatttttttatttattttc
caaggggtttatactagaagatatgatttttggcatgagagctacattatagtcaggagc
tgctttttggggctatttttgagccttgcgatcttggctttgataaagataaattatgaa
tattcaagaacggtttttattttgagctttatttttatgatgtttttgctgccgatatcg
aaatttatactaaaaagacagctttttgcgataggaatttggcaaaaaagagcaaaagtt
atcggcaaaaatacggactttgagcttgaaatttttacaaatcgatatcttggatatgtg
aaagagacgggtggaggttacgaatctctttttataaccaatgagaaattaaaacccgaa
attttaaatgagctgatcgagcaaaatataattgcgaataaagaaattttattcgcgccc
atgttgcaaacctatgatttcacaaaagcccatatttatggtttttttaattctaggaca
aatatttttgctatccaaaattctttaaaaagtaggtcgcgtatggtaatgaaaagatac
cttgacatcgtgcttatcgtccttgcacttcctgttttagtgccgatatttttaataata
atggctatgataaagataaaagagccaaatgcaaagatatttttctcgcacgaaaggatg
gggcgaaatggcaggctttttggatgcttgaaatttaggtctatgcgtgaaaacagctcg
caaattttgcaggagtatctaaaagcaaatccacaagaaaacgagtattttgaaaaatat
cacaaatatgagcacgacccaaggatcacaaaatttggaaattttatccgcaagacttct
cttgatgagttgccccagcttatcaacgtgttaaaaggtgagatgagcatcgtaggtcct
agaccctgcgctcagtatgagaaaaaggatatgggtaaatacgcagaccttatccttgcc
gtgcgtccaggcatcaccggcatctggcaggtcagcggtaggagcaatgttgattttgaa
accagagcgcagatggatgcgtggtatatgaaaaattggagtatttggaacgacatcgtc
atcattatcaaaacatttaaggtcgttttggcgcgcaaaggagcaagttag

DBGET integrated database retrieval system