KEGG   Campylobacter curvus: CCV52592_0456Help
Entry
CCV52592_0456     CDS       T00576                                 

Gene name
kdsC
Definition
(GenBank) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
ccv  Campylobacter curvus
Pathway
ccv00540  Lipopolysaccharide biosynthesis
ccv01100  Metabolic pathways
Module
ccv_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:ccv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CCV52592_0456 (kdsC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ccv01005]
    CCV52592_0456 (kdsC)
Enzymes [BR:ccv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     CCV52592_0456 (kdsC)
Lipopolysaccharide biosynthesis proteins [BR:ccv01005]
 Unusual sugar
  CCV52592_0456 (kdsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 Hydrolase HAD Mastoparan_2
Motif
Other DBs
NCBI-ProteinID: EAU00752
UniProt: A7GXG3
Position
639024..639512
Genome map
AA seq 162 aa AA seqDB search
MIEIIFLDVDGCLTDGKIVYSANGEELKFFDVKDGYAIESWLKLGKKAAIITGRKSPIIE
RRAEDLKINHVYQGVSDKFEVAKEILKFEGLSFENSAAIGDDYNDFKILNAVAWSFKPKD
AIKQLEVKTKLKHKGGAGAVREMIEIIIEKQNLFDEWSKRWL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatagagatcatatttttagatgtcgacggctgcttgactgatggtaagatcgtttat
agtgcaaacggcgaggagcttaaattttttgacgtgaaggacggctacgccatcgagagt
tggctgaagcttggtaaaaaagccgccatcatcacgggcagaaaatcccctatcatagag
cgacgcgctgaggatctaaagataaatcacgtctatcagggcgttagcgataaatttgaa
gtagccaaggaaattttgaaatttgaagggcttagctttgaaaactccgcagcaatcggc
gatgattataacgactttaaaattttaaatgccgtggcatggagcttcaagccaaaagac
gccataaaacagcttgaggttaaaacgaagctcaagcacaaaggcggcgccggtgccgtg
cgcgagatgatcgagatcatcatcgaaaagcaaaatttatttgacgagtggtctaagcgt
tggttataa

DBGET integrated database retrieval system