KEGG   Campylobacter curvus: CCV52592_0948Help
Entry
CCV52592_0948     CDS       T00576                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ccv  Campylobacter curvus
Pathway
ccv00860  Porphyrin and chlorophyll metabolism
ccv01100  Metabolic pathways
ccv01110  Biosynthesis of secondary metabolites
ccv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CCV52592_0948 (hemD)
Enzymes [BR:ccv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CCV52592_0948 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: EAU00010
UniProt: A7GX74
Position
540577..541221
Genome map
AA seq 214 aa AA seqDB search
MAEIYLVSNTPSNDESMINLPVSEIKFLKFSLNLDEFDALVATSKNSFKALEFNHIKIKP
DMQIYAIGEPCAKAAKRCGFSKIYTAKNSHGGEFAAEISPLLKGKKTLYLRAKSIVSNLG
EILKQNGILVSQIVAYESVCARLDKEKMPPENSVLIFSSPSNVKNFILNFGWLDSYKAVA
IGETTAKELAKFTDPLVSARQEINACVELAKTLL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatttatctcgtctcaaatactccctcaaatgatgagagcatgataaacctg
cctgtaagcgagataaaatttttaaaatttagtctaaatttagatgaatttgacgcgctc
gtggcgacctctaaaaactccttcaaagccttagaatttaatcatataaaaataaaaccg
gatatgcaaatttacgctatcggcgagccgtgcgccaaggctgccaagagatgtggtttt
agtaaaatttatactgctaaaaattctcacggaggcgaattcgccgctgaaatttcgcct
cttttaaaaggcaaaaagacgctttatctaagagctaaaagcatcgtttcaaatttaggc
gaaattttaaagcaaaacggcattttagtaagccagatcgtagcctatgagagcgtttgc
gccaggcttgacaaagaaaaaatgccgcctgaaaatagcgttttgatcttttcctctccg
tcaaacgttaaaaatttcatcctcaattttggctggcttgatagctacaaagccgtagcc
atcggtgaaacgacggcaaaagagctggcgaaatttacagatcccctcgtgagtgcgagg
caagaaataaatgcctgtgtagagcttgccaaaacgttactttaa

DBGET integrated database retrieval system