KEGG   Campylobacter curvus: CCV52592_1158Help
Entry
CCV52592_1158     CDS       T00576                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ccv  Campylobacter curvus
Pathway
ccv00430  Taurine and hypotaurine metabolism
ccv00620  Pyruvate metabolism
ccv00640  Propanoate metabolism
ccv00680  Methane metabolism
ccv01100  Metabolic pathways
ccv01120  Microbial metabolism in diverse environments
ccv01200  Carbon metabolism
Module
ccv_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ccv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCV52592_1158 (ackA)
   00640 Propanoate metabolism
    CCV52592_1158 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    CCV52592_1158 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CCV52592_1158 (ackA)
Enzymes [BR:ccv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CCV52592_1158 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: EAT99809
UniProt: A7GYC8
Position
complement(946548..947744)
Genome map
AA seq 398 aa AA seqDB search
MKILVLNSGSSSIKFQLFLMEENRSIASGIVEQIGSENSRAVLKANSKEYEKKRAIKDHH
EGLDVMNELFRESNTLHDLSELDGIGHRIVHGGESFFSSMIVDDSVIAKIEQISPLAPLH
NPGHIAGIKNAMQSSGDVPHVVVFDTVFHQTMPEYAYRYALPYDICKEHHIRKYGFHGTS
HRYVCKRAASLMGMEFQNFNAISLHLGNGASACAVQNGKSIDTSMGLSPLEGLIMGTRSG
DMDPAVVVYLLNIGVLKWDEIDTFLNKKSGLFGICGSSDMRDVVTRMANDERAKLAFEMF
CYRVKKYIGAYYAVLGHVDALIFTGGIGENAPNTRQKICDDLKHLGIHVNHDLNFSKERG
ERCLDDKNAKIKTFVIPTNEELEIAIETMRVIKERAKI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttggttttaaactctggtagtagctctataaaatttcagctatttttaatg
gaagaaaatcgcagcatagcaagcggcatcgtggagcagatcggtagtgaaaattctcgc
gccgtgcttaaagcaaactcaaaagaatacgagaaaaaaagagcgataaaagaccaccac
gaggggcttgacgtgatgaacgagctctttcgcgagtcaaacactttgcatgatcttagc
gagctcgacggcatcggacaccgtatcgtgcatggcggcgagagcttttttagctcaatg
atagtagatgactccgtgatagccaagatcgagcagataagcccgctagcaccgcttcat
aatcccggtcacatagccggcataaaaaacgccatgcaaagtagcggcgacgtccctcac
gtggtggtttttgacaccgtgtttcatcagactatgccagaatacgcctaccgatacgcc
ctgccctacgacatctgtaaagagcatcacatcagaaaatacggctttcacggcacgtct
catagatatgtgtgcaagcgtgcggcaagcttgatggggatggaatttcaaaatttcaat
gccatttcgctgcaccttggcaatggagcgagcgcttgcgcggtgcaaaacggcaaaagt
atcgacacctcgatgggtcttagtccgctcgaggggctcataatgggcactagaagcggt
gatatggatcctgctgtagtcgtgtatctgctaaatatcggcgtcttgaaatgggacgag
atagatacgtttttaaataaaaaaagcggtctctttggtatctgcggctctagcgacatg
cgtgatgtggtcacaagaatggcaaacgacgagcgagccaagcttgcttttgagatgttt
tgctaccgtgtcaaaaaatatatcggagcctactatgcagtacttggccatgtcgatgcg
ttgatatttactggcggcataggagagaacgcgccaaataccagacaaaaaatctgcgat
gatctaaaacacctgggcatccacgtaaatcacgatctaaatttcagcaaagagcgcggc
gagcgatgtttggatgataaaaacgcaaagataaagaccttcgtaataccaacaaatgaa
gagttggagatcgctattgagaccatgagagtgattaaagaaagagcgaaaatttag

DBGET integrated database retrieval system