KEGG   Campylobacter curvus: CCV52592_1687Help
Entry
CCV52592_1687     CDS       T00576                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ccv  Campylobacter curvus
Pathway
ccv00260  Glycine, serine and threonine metabolism
ccv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccv01100  Metabolic pathways
ccv01110  Biosynthesis of secondary metabolites
ccv01130  Biosynthesis of antibiotics
ccv01230  Biosynthesis of amino acids
Module
ccv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CCV52592_1687 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCV52592_1687 (trpA)
Enzymes [BR:ccv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CCV52592_1687 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: EAU01050
UniProt: A7H066
Position
complement(1604334..1605083)
Genome map
AA seq 249 aa AA seqDB search
MDKIARAFEGKKANIGYIVAGYPSLEHTKEFLLNLDASSLDLLELGIPYSDPLADGKLIA
QASFETAAKGVNTDTIFEILDEVKADVKKPIVFLVYYNIVFAYGVEKFIKRSGEVGISGF
IIPDLPFEECEEVRSLCDKFKLDLIPLISVTSAGRADKILSVGSGFIYALGAIGVSGSQR
ASEERLKSLVASLKQKSDLPVAVGFGVKNAQDANLVKSYADGAIIGTQIVKLTAKFSGDE
LVSQIEKLF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggataagatcgcgcgcgcatttgagggcaaaaaggcaaacatcggctacatcgtggca
ggctacccaagcttagagcacacgaaggagtttttgttaaatttagacgccagctcgctt
gacctattggagcttggcataccatactccgacccgctagcagacggcaagctcatcgcc
caggctagctttgagaccgcggcaaagggcgtaaataccgatacgatctttgaaattttg
gacgaggtcaaggcggatgtgaaaaagccgatcgtttttttggtgtattacaacatcgtc
tttgcttatggcgtggagaaatttatcaagcgttccggcgaggtcggcatcagcggcttt
atcatccccgatctgccctttgaagagtgcgaggaggtacgctcgctgtgcgataaattt
aagcttgatctcatcccgctcatcagcgtgacgtcagccggcagagcggataaaatttta
agtgtgggctcaggcttcatctacgcgctgggggctatcggcgtgagcgggtcgcaaaga
gccagcgaggagcggctaaaaagcctagtcgctagcttaaagcaaaaaagcgatctgccc
gtggctgtgggctttggcgtgaaaaatgcgcaagacgcaaatttagtcaaatcctacgcc
gacggtgcgatcatcggcacgcagatcgtaaagctcacggctaaatttagcggagacgag
ctagttagccagatagaaaagcttttttga

DBGET integrated database retrieval system