KEGG   Campylobacter curvus: CCV52592_1882Help
Entry
CCV52592_1882     CDS       T00576                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ccv  Campylobacter curvus
Pathway
ccv00020  Citrate cycle (TCA cycle)
ccv00640  Propanoate metabolism
ccv00660  C5-Branched dibasic acid metabolism
ccv01100  Metabolic pathways
ccv01110  Biosynthesis of secondary metabolites
ccv01120  Microbial metabolism in diverse environments
ccv01130  Biosynthesis of antibiotics
ccv01200  Carbon metabolism
Module
ccv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ccv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCV52592_1882 (sucC)
   00640 Propanoate metabolism
    CCV52592_1882 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CCV52592_1882 (sucC)
Enzymes [BR:ccv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CCV52592_1882 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: EAU00099
UniProt: A7GYI5
Position
complement(1016769..1017941)
Genome map
AA seq 390 aa AA seqDB search
MNIHEFQAKEILKRYGVNVAKGAVAENLEQASEILNDLEGEIFALKAQIHAGGRGLAGGV
KIASSREQAIQFASKLLGMTLITPQTPKNGILVRKIYIEEGLNFKQEIYLSLAFDRNSEK
ISLIVSKDGGVSIEETAKQNPHLIKTISIDPQIGLCGFHTKELINFLQIDKILWSKLDTL
LQNLYKIYIFKDANLIEINPLVLTQDDEFYALDAKMSFDDSALFRHEDIRALNDETQTDT
SENEAKAQRLNYIKLEGSVGCVVNGAGLAMATMDIIKELGGEAANFLDVGGAATGEGVAK
AFRLILNDRRVKVIFVNIFGGIVRCDRIAAGIIEACQSTPLGVPVVVRLDGTNAKEALDM
LKNSALKGLHTSDDLFEGARLAVMLAKGEK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgaatttcaggccaaggaaattttaaaacgatacggcgtaaatgtcgca
aaaggcgcagtggctgaaaatttagagcaggcgagcgaaattttaaacgatcttgaaggc
gagatttttgccctcaaagcgcagatacatgccggtgggcgcggtttggccggcggcgtg
aagatagcgagctctcgcgagcaggcgatacagtttgcatcaaagctgctaggcatgacg
ctcatcacgcctcaaacgcctaaaaacgggatattagtgcgtaaaatttatatcgaggag
gggctaaatttcaaacaagaaatttacctcagcctcgcctttgacagaaatagtgaaaaa
atcagcctcatcgtctctaaagacggcggtgtcagcatcgaagagaccgccaaacaaaac
ccgcatctcataaaaaccataagcatcgacccacagatcggactttgcggttttcacacc
aaagagctcataaatttcttacagatcgataaaattttatggagcaagctagatacgctg
ctacaaaatctttataaaatttacatctttaaagacgcgaatttaatagagataaaccct
ctcgtgctgacgcaagatgatgaattttacgcgcttgatgcgaagatgagctttgatgat
agcgcgctctttcgccacgaggatatcagagctttaaacgacgagactcaaaccgacact
agtgaaaacgaagccaaggcgcaacgcctaaactacatcaagcttgagggtagcgtgggc
tgcgtggtaaatggcgcggggctcgcgatggctacgatggatatcatcaaagagcttggc
ggcgaggcggcaaatttcctagacgtaggcggtgcggcgacaggcgagggcgtagcgaag
gcttttaggctgattttaaacgatcggcgcgtgaaggtgatatttgtaaatatatttggc
ggtatcgttcgctgcgaccgtatagctgcgggcatcatcgaggcttgccagagcacaccg
cttggtgtacctgtggtcgtgaggcttgatggcacgaacgctaaagaagcgcttgatatg
ctaaaaaattccgccctaaaggggctacatacgagcgacgatctatttgagggagcaagg
ctggctgtcatgctcgcaaagggcgaaaaatga

DBGET integrated database retrieval system