KEGG   Corvus cornix (hooded crow): 104683355Help
Entry
104683355         CDS       T03546                                 

Gene name
SUCLG2
Definition
(RefSeq) succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial isoform X1
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00020  Citrate cycle (TCA cycle)
ccw00640  Propanoate metabolism
ccw01100  Metabolic pathways
ccw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104683355 (SUCLG2)
   00640 Propanoate metabolism
    104683355 (SUCLG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccw04147]
    104683355 (SUCLG2)
Enzymes [BR:ccw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     104683355 (SUCLG2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     104683355 (SUCLG2)
Exosome [BR:ccw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104683355 (SUCLG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 104683355
NCBI-ProteinID: XP_010388507
Position
Unknown
AA seq 415 aa AA seqDB search
MWEKHLLLAQKTVQLTPRRWLNLQEYQSKKIMADHGVTVQRFFVADSANDALEAAQRLKA
KEIVLKAQILAGGRGKGIFNSGLKGGVHLTKDPKTVEQLAKQMIGYNLSTKQTPKDGVTV
KKVMVAEALDISRETYFAILMDRACNGPVMVGSPQGGVDIEEVAVTSPELIFKEEIDIFE
GIKDHQALQMAKNLGFQGPLQQQAADQIKKLYNLFLKIDATQVEVNPFGETPEGQVVCFD
AKINFDDNAEFRQKEIFAMDDKSENEPIENEAAKYDLKYIGLDGNIACFVNGAGLAMATC
DIISLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNIFGGIVNCAIIANGIT
KACQELELKVPLVVRLEGTNVHEAQRILSESGLPITSANDLEDAAKKAVASVAKK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtgggaaaagcatcttttgctggcacaaaagactgttcaattaacccccagacgatgg
ctcaacctgcaggagtaccaaagcaaaaaaataatggcagaccatggggttacagttcag
agattctttgtagctgattctgcaaatgatgccctggaggctgctcagagactgaaggca
aaggaaattgttctgaaggcacagattctggctggagggagagggaaaggtattttcaat
agtggattgaaaggaggagttcatctaactaaagaccctaagactgttgaacagcttgct
aaacagatgattgggtacaatctgtcaaccaagcaaactccaaaggatggtgtgacagtt
aaaaaggtgatggttgcagaagcactggatatttccagggaaacatactttgcaattctg
atggacagagcctgcaatggacctgtcatggttggcagtcctcagggtggtgtggacata
gaagaagttgcagtaactagcccagaacttatctttaaggaggaaatagatatttttgaa
ggcataaaggatcatcaggcgttgcagatggcaaaaaatttgggattccaaggacctttg
cagcagcaggcagcagatcaaattaagaagctgtataatcttttcttgaaaattgatgcc
actcaggttgaagtcaatccctttggtgaaactccagaagggcaagttgtttgcttcgat
gccaagataaactttgatgacaacgcagaatttaggcaaaaagaaatatttgccatggat
gacaagtctgaaaatgagcccatagagaatgaagctgccaaatatgacttaaaatatata
ggactggatggaaacattgcttgctttgtcaatggagctggacttgcaatggcaacgtgt
gatataatatccctgaatggtggaaagccagccaacttcttggatctcggtggaggcgtg
aaagaagcacaagtctatcaagcattcaagctgctgactgctgatccaaaggttgaagca
atccttgtaaacatatttggtgggattgtgaactgtgccattatagccaatggtatcacc
aaagcctgccaagagctcgagctgaaagtacctctggtggtcagactggaaggaacaaat
gtccatgaagcccagcgtattctgagtgaaagtggcctccccatcacatctgccaatgac
cttgaggatgcagcaaagaaggcagtggcaagtgtggccaaaaaataa

DBGET integrated database retrieval system