KEGG   Corvus cornix (hooded crow): 104683676Help
Entry
104683676         CDS       T03546                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X2
  KO
K17890  autophagy-related protein 16-1
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04136  Autophagy - other
ccw04140  Autophagy - animal
ccw04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104683676 (ATG16L1)
   04136 Autophagy - other
    104683676 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104683676 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccw04131]
    104683676 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:ccw03029]
    104683676 (ATG16L1)
Membrane trafficking [BR:ccw04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    104683676 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    104683676 (ATG16L1)
Mitochondrial biogenesis [BR:ccw03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    104683676 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 Ge1_WD40 ERM Fez1 KASH_CCD SGL Peptidase_M15_4 HTH_6 WD40_like Lipoprotein_6 V_ATPase_I YicC_N YabA
Motif
Other DBs
NCBI-GeneID: 104683676
NCBI-ProteinID: XP_010388909
Position
Unknown
AA seq 561 aa AA seqDB search
MQSRHESSPGHDGTWNDAQLQELAQLKIKHQEELTELHKKRGELAQSVIDLNNQMQQKDK
EMQMNEAKIAEYLQKISELETECQELRSKLQDLERANQTLKDEYDALQITFNALEEKLRK
TTEDNQELVSRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEPDDDIEV
LVDETSDTAEETSPVPAVSRTSSKRLSQPAGGLLDSISNIFGLSESPLLGHQSSDTARRR
SVSSFPAPQDNVEPHPGASKEVRVPTTAICVFDAHDGEVNAVQFSPGSRLLATGGMDRRV
KLWEVLGDRCEPKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDNRLRHTLTG
HSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGH
FDKKIRFWDIRTESIVKELELLGRITALDLNPERTELLTCSRDDLLKIIDLRVSAVKQTF
SAQGFKCGSDWTRVVFSPDGNYVAAGSADGALYVWNVLTGKLERTLAKHHSSSINAVAWS
PAGAHVVSVDKGNKAVLWSEF
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcagagtagacatgagtccagcccaggacatgatggcacatggaacgatgcacagctg
caggaactggcccagctgaagataaagcaccaagaggagctgactgagctgcacaagaaa
cgtggcgagctggcccagtctgtaattgatctgaacaaccaaatgcagcagaaagacaag
gagatgcagatgaacgaagccaagattgcagagtatttgcaaaagatttctgaactggaa
acagagtgccaggaattgcgtagcaaactgcaagatcttgagcgagctaatcagacactg
aaagatgaatatgatgctctccagatcaccttcaatgccttggaggagaaactaaggaaa
actactgaagacaaccaggagctggtctcacgttggatggcagagaaagcacaagaagcc
aatcgtttgaatgcagaaaatgaaaaggattcaaggagacgccaggccaggctgcagaag
gagctggcagaagctgccaaagagcccttgcctgttgaaccggatgatgatatcgaagtg
cttgtggatgaaacctctgacacagctgaggaaacttctccggtgccagctgtcagccgg
acatccagtaagcgactctcccagccagctggaggccttctggactctatcagtaatatc
tttggtctgtctgagtctccccttttgggacatcagtcttctgatactgccaggaggcgt
tctgtgtcctcattccctgcaccccaggataatgtagagccacatccaggtgccagtaaa
gaagtgagagtgcccactactgccatatgtgtctttgatgcacatgatggggaggtgaat
gcagtgcagttcagccctggctcccggttactagcaacaggaggcatggaccggagggtt
aagctgtgggaagtcttgggagataggtgtgagcccaaaggttccctctctggcagtaat
gctgggattacaagcatagaatttgatagtgctggttcttacctcttagcagcttcaaat
gactttgccagcagaatctggacagttgatgacaatcgattacggcacaccctgacaggt
cacagtggtaaagtcctgtcagccaagttcttgctggacaatgcacgtattgtttcggga
agtcacgaccggaccctcaagctctgggacctccgcagcaaagtttgtataaaaacagtg
tttgcaggatctagctgcaatgacattgtgtgtactgagcagtgtgtaatgagtggacat
tttgataagaaaattcgtttctgggacatcaggactgaaagcatagtgaaagaactggag
ctgcttggaagaatcacagctctggacctgaatccagagcgaacagagcttctgacctgt
tcccgtgatgatctactcaagatcatcgatctgcgggtcagtgctgtcaagcagacgttc
agtgcccagggattcaaatgtggctccgactggacgagagttgtgttcagccctgatggt
aactatgtggctgctggctcagctgatggggccctctacgtttggaatgtgcttactggg
aaattggagaggacgcttgcaaagcatcacagttcttctatcaatgcagtcgcgtggtcg
ccagcgggtgcccacgtggtcagtgtggacaaaggaaacaaggctgtgctgtggtctgag
ttttga

DBGET integrated database retrieval system