KEGG   Corvus cornix (hooded crow): 104684201Help
Entry
104684201         CDS       T03546                                 

Gene name
PIK3C2A
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha isoform X1
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00562  Inositol phosphate metabolism
ccw01100  Metabolic pathways
ccw04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104684201 (PIK3C2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    104684201 (PIK3C2A)
Enzymes [BR:ccw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     104684201 (PIK3C2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135 BLUF
Motif
Other DBs
NCBI-GeneID: 104684201
NCBI-ProteinID: XP_010389745
Position
Unknown
AA seq 1702 aa AA seqDB search
MDICSCGMAQISSSNGFKQRSSPSLSAPRSKDVDKEEALQMEAEALAKMQKERGVAGNKQ
TFHSLSSPRQKAQTHNKQDHDLMVFPESDAKSMEDKLSTIDIEKLTHAELEKLLLDDNFE
SSKVPTLPASPILSPSVSSQFYLGSVGQRRQWTPGIPAPVTCTLPPIYTSASYTKQTGVF
QNGFHPSMSSYPSREPIYLGLPRQSQYVSYPVAATIPFHPHGGLPLYPPVLTPEMAKVFD
KIASTSEFLRNGKSSADLEMTAIKSAVSSLPASDSCGDVSKFDWLDLDPLSKPKVDAVET
LNKAEDDGERASSMTAEDPWDAVLLEEKLLLTCHLERKVNGKSSGATVTRSQSLNMRTTQ
LAKLQGQTSQLQKDNGTTGTLTENVLLQAIEGQNQELSAFSEAVTKLRTKFPYTDQQTNP
GFVLSPIMLQRNISGESASIKVSIEIEEFQQPVTFTCDVSSPVELIIMQALCWVHDDLNE
VDIGSYILKVCGQEEVLQNKHCIGSHEYIQNCRKWDTDIKLQLLTHSGICSDLARTEDDD
RTPVHLTKHLYKVEKPFREPIIRSSIEELLEVYHKQVNIALKSENQHKAVDHVIRTVRKI
CSTLDCVETPAITDSVKKLRRAVNLPRTKNAEVSLKCGDDNSKCFSGSQQPENPLKVSIN
QLTRAVEALLRLHTNSCSSSAAVSPEETKSTQEAWTATEHLQFTIFAAHGISSGWVSNYE
KYYLICSLTHNGKDLFKPVQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLCLTLF
GILNQSSGSSPDSNKQRKGPEILGQVSLPLFDFRRLLTCGTKLLQLWTSSHPHHVSGTTS
KKGNMERIVLQIDFPSHAFDIEYKIPQAAKTTVHLSVETLEKPSRERLLAILSKDSTIGL
SKEDKEFLWEKRHYCHSHTNSLPKILVSAPHWDWASLPEIYSLLQRWPPLSPLAALELLD
SKFADQEVRNTAVNWIETLSDDELTDFLPQFVQALKYETYLDSALVKFLLARALGSIRIA
HYLYWLLKDTLYDTKFGVRYEQILGAFLSVCGKRLREELEKQTRLVQLFGMVAERVKQTS
GSARQVALQNGMERVQLFFLKNKCRLPLNPSLVAKELNIKACSFFSSNAVPLKVALINAD
PLGEEINVMFKVGEDLRQDMLALQMIKIMDKIWLQEGLDLRMVIFKCLSTGKDRGMVELV
PASDTLRKIQVEYGVTGSFKDKPLAEWLRKYNPTEEEYEKASENFIYSCAGCCVATYVLG
ICDRHNDNIMLRNTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTI
RFQLFVDLCCQAYNLIRKHASLFLNLLSLMLSSGLPELSGVQDLKYVQDALQPQTTDAEA
TIFFTRLIESSLGSVATKFNFFIHNLAQLRFSGLPSNDEPILSFSAKTYSLKQDGRIKQV
SVFTYQKRYNPDKHYIYVVRVLREGQVEPTFVFRTFDEFQELHNKLGILFPLWKLPGFPN
KMVLGRTHIKDVAAKRKVELNSYIQSLMNSSPEVAECDLVYTFFHPLLRDDKVEGIDGIA
RPADTSPSSPTSGKVGGEVKLSISYRNSTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDT
HKTSKRKTKISRKTRNPTFNEMLVYSGYSMETLKQRELQLSVLSAESLRENFFLGGITLP
LKDFNLSKETVSWYRLTAVPYL
NT seq 5109 nt NT seq  +upstreamnt  +downstreamnt
atggacatctgctcttgcggcatggcccagatatccagcagcaatggattcaaacagcgc
tcctcaccttctctgtcagccccaaggtcaaaagatgtggacaaagaggaggcactgcag
atggaagctgaggcattagccaagatgcagaaagaaagaggtgtagctggtaataaacaa
acctttcattctttaagcagtcccagacaaaaagcacagactcataacaaacaggaccat
gatctcatggtgtttccagagtctgatgccaagagcatggaagataaactaagtaccatt
gacatagagaagcttactcatgctgaactagagaaactgctgctggatgacaattttgaa
tctagtaaagtacctacgttaccagcaagtcctattttgagcccctctgtgtcttcacaa
ttttatcttgggtccgtgggtcagaggagacagtggacacctgggataccagcacctgtg
acatgcactttacctcctatttacacctcagcttcttatacaaaacagactggtgtattt
cagaatggattccatccaagtatgtcgtcctatccctctagagagcctatttatcttggt
cttccaagacagtcacaatacgtttcatacccagtggcagctaccatacctttccatcca
cacggaggcctacctttataccctccagtactcacaccagaaatggcaaaagtatttgac
aaaattgcaagcacttcggaattcctgagaaatgggaagtcgagtgcagacctagaaatg
actgccataaagtctgcagtctccagcctgccagcctcggatagctgtggggatgtcagt
aaattcgactggttggatttggatcctctgagtaaaccaaaagtggatgctgtggagact
ttaaacaaggcagaggatgatggagagagggcttcaagtatgactgctgaagatccatgg
gatgctgttctgttagaagaaaagctgttactgacttgtcatctggaaagaaaagttaat
gggaaatcttctggagcaacagtcacaaggagtcagtccttaaacatgagaacaactcag
cttgcaaagttacagggccaaacatcgcagttgcagaaagacaatgggaccactggcacg
ctgacagaaaacgtgcttctccaagcaattgaagggcagaatcaagaactgtcagctttt
tctgaagcagttacaaaattgaggaccaagtttccttatactgatcagcaaacaaaccca
ggctttgtgctgagtccaatcatgctgcaaagaaatataagtggggagagtgccagtatc
aaggtttcaatagaaatcgaagaattccagcaaccagtaacttttacatgcgatgtgagt
tcccctgttgagcttataataatgcaggcactttgctgggtgcatgatgacttgaatgaa
gtggacattggcagctatatcctgaaagtctgtggccaagaagaagttttacagaacaag
cactgcataggaagtcacgagtatatccagaactgccggaagtgggacacagacatcaaa
ctgcagctcctgacccacagcgggatatgcagcgacctggcacgaacagaagatgatgac
aggacacctgtacatctaaccaaacacctctacaaagtagaaaagcctttcagagaacct
atcataaggtcttccattgaagagcttcttgaggtgtatcacaagcaagttaacatagcc
ctcaagagtgagaaccagcataaagcagtagatcatgtaattaggactgtcagaaaaatc
tgttctacattggattgtgtagagactcctgcaataacggactccgtgaagaagctaagg
agggctgttaatctcccaaggactaaaaatgctgaggtatccttaaaatgtggtgatgac
aatagcaagtgcttctctggttcacagcagcctgaaaaccctctgaaagtgagtataaac
cagttaacaagagcagttgaggcccttctgcgactccatacgaattcctgtagtagttca
gcagcagtttctccagaagagactaagagtacccaggaagcttggactgccacagaacat
ctccaattcacaatatttgctgctcatggaatttcttctggttgggtgtcaaattatgaa
aaatactacttgatttgttccctgacccataatggaaaagatctgttcaaacctgttcag
tccaagaaggttggcacatacaagaacttcttctacttgattaaatgggatgaactaata
attttccccatccagatttcacagttgcctttggaatcagtcttatgtctgactttgttt
ggaatcctaaatcaaagtagtgggagttcccctgactcaaataagcagagaaagggccca
gaaattttgggtcaggtttctctacctctttttgattttaggcgattgttaacttgtggg
acgaagctcttgcaactgtggacctcttcacatccgcatcatgtgtcagggacgaccagt
aagaaaggaaacatggaaagaatagtattgcagattgacttcccatcccatgcatttgat
attgaatataaaattcctcaagctgcaaagactactgtgcatctttctgtagaaacatta
gaaaaaccatcgagagaacgtctccttgccattctctccaaggatagcactattgggctg
tcgaaagaagataaagaatttttgtgggagaagagacattattgtcacagccatactaac
agcctaccaaaaatcctggttagtgcccctcactgggactgggcaagtcttccagaaata
tattcgttacttcagcggtggcctcctttatcacccttagctgcactagaactacttgat
tcaaagtttgctgatcaggaagtacgaaatacagctgtgaactggatagagacactgagt
gatgatgagttaacagatttcctccctcagtttgtacaggcactgaagtatgaaacctac
cttgacagtgcccttgtgaaatttcttttggctcgggcactgggaagcattcggattgca
cactacctgtactggcttcttaaggatacactgtatgatacaaagtttggtgtaaggtat
gagcaaattcttggagcttttctttcagtctgtgggaaaaggctgagggaagagctggag
aagcagaccaggctagtgcagctctttggaatggtagcagaaagagtaaagcaaacgagt
ggatctgctcggcaggttgccttgcaaaatggcatggagcgtgtgcagttatttttcttg
aagaacaaatgccgtttgcctctcaatcccagtcttgtggcaaaagagttaaatattaag
gcgtgttctttcttcagctccaatgcagtaccactcaaagttgcactgataaatgctgac
cctctgggagaagaaattaacgtgatgtttaaggttggagaagatctgagacaagatatg
ttggctttacaaatgattaagattatggataagatctggctgcaggagggactggatcta
cggatggttatcttcaagtgtctctcaactggaaaagacagaggcatggtagagcttgtt
cctgcttcagatacacttaggaaaattcaagtggaatatggagtgacaggttcttttaag
gacaagcctctggcagagtggttgcgaaagtacaatcctacagaggaggagtatgaaaag
gcttcagaaaacttcatctactcttgtgcaggatgctgtgtagccacgtatgtcctggga
atctgtgaccgtcacaatgataacataatgctccggaacactgggcatatgtttcacatc
gactttggaaagtttctgggacatgcacagatgtttggtagctttaaaagggatcgagct
ccttttgtgctgacatcagatatggcttatgtcataaatggtggggaaaaacccacaatt
cgctttcagctgttcgtggatctctgctgccaagcttacaacttgatcagaaagcatgcc
agcctcttccttaacctactgtcattgatgctttcttctgggttaccagagctaagcggg
gttcaggacctgaagtatgtccaggatgctctccagccgcaaacaacagatgcagaagcc
accatcttctttacaaggctgatcgaatccagtctgggcagtgttgccacaaagttcaat
ttcttcattcacaatttggctcagctgcgtttctcaggtctgccttctaatgatgagccc
atcctgtcattttctgctaaaacctattctctcaaacaagacggccgaatcaaacaagtg
tctgtgtttacgtatcagaagagatacaacccagataaacattacatctatgtagtgaga
gttttgagagaagggcaagttgagccaacatttgtcttccgaacatttgatgagttccag
gagctccacaacaaacttggcattctctttcctctttggaagttaccaggctttcctaat
aagatggtgctgggaagaacacatatcaaagatgtagcagccaaaagaaaagtggagctc
aacagctacatacagagcctgatgaacagttctccagaggtggcagaatgtgatcttgtt
tatacttttttccatccattacttcgtgatgacaaagtggaaggaatagatggaatagcc
agacctgcagatacaagtccatcaagtcctacctcaggcaaagtgggaggagaagtgaaa
ctatccatatcctatagaaatagcaccctatttatcatggtgatgcacatcaaagacctg
gttacagaagatggtgcagatccaaatccctatgtgaaaacttacttactcccagacacg
cacaaaacatccaaacgcaaaaccaaaatctcccggaagacaagaaacccaactttcaat
gaaatgctcgtgtacagtggatacagcatggagacgctgaaacagagggagctgcagtta
agtgtgctcagtgcagaatcgttacgtgagaacttcttcctaggtggaattacactccca
ctgaaggacttcaacctgagcaaggagactgttagctggtatcgactgactgctgtaccc
tatctgtga

DBGET integrated database retrieval system