KEGG   Corvus cornix (hooded crow): 104684986Help
Entry
104684986         CDS       T03546                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04010  MAPK signaling pathway
ccw04260  Cardiac muscle contraction
ccw04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104684986 (CACNG3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104684986 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    104684986 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccw04040]
    104684986 (CACNG3)
Ion channels [BR:ccw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104684986 (CACNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 104684986
NCBI-ProteinID: XP_019137021
Position
Unknown
AA seq 167 aa AA seqDB search
MKSPGQGTFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSIFPILSVGLLFFGGLCVAA
SEFYKSKHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQSDSKKSYSYGWSFYFGAL
SFIIAEMVGVIAVHMYIEKHRQIRARSHSELLKKSAFTQGEHLVCIV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtccaggccagggaaccttccgaggagtgtgcaagaaaatcgaccacttccct
gaggatgcagactacgagcaagacacagccgagtatctcctccgtgcggtgagagcgtcc
agcatcttccccatcctcagcgtggggctgctgttcttcgggggcctgtgtgtggccgcc
agcgagttctacaagagcaaacacaacgtcatcctcagcgctggcatcttcttcgtctct
gcaggtctcagcaacatcatcgggatcatagtctacatctcggccaacgcaggggacccg
gggcagagcgactccaagaagagctactcctatggctggtccttctacttcggagcactg
tccttcatcatcgccgagatggtgggggtgatcgccgtgcacatgtacattgagaagcac
cgccagatccgcgccaggtcccactcggagctgctgaagaagtcggccttcacccaaggg
gaacatctggtgtgcattgtgtga

DBGET integrated database retrieval system