KEGG   Corvus cornix (hooded crow): 104685626Help
Entry
104685626         CDS       T03546                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2
  KO
K13376  transforming growth factor beta-2
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04010  MAPK signaling pathway
ccw04060  Cytokine-cytokine receptor interaction
ccw04068  FoxO signaling pathway
ccw04110  Cell cycle
ccw04218  Cellular senescence
ccw04350  TGF-beta signaling pathway
ccw04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104685626 (TGFB2)
   04350 TGF-beta signaling pathway
    104685626 (TGFB2)
   04068 FoxO signaling pathway
    104685626 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104685626 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104685626 (TGFB2)
   04218 Cellular senescence
    104685626 (TGFB2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104685626 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccw04052]
    104685626 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:ccw00536]
    104685626 (TGFB2)
Cytokines and growth factors [BR:ccw04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   104685626 (TGFB2)
Glycosaminoglycan binding proteins [BR:ccw00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   104685626 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 104685626
NCBI-ProteinID: XP_010391887
Position
Unknown
AA seq 412 aa AA seqDB search
MHCYLLSVLLTVDLATVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPDEYPEP
EEVPPEVISIYNSTRDLLQEKANHRAATCERERSDEEYYAKEVYKIDMQPFYPENAIPPS
YYSLYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNSKARVSEQRIELYQVLKSKELSSPG
QRYIDSKVVKTRAEGEWLSFDVTEAVHEWLHHRDRNLGFKISLHCPCCTFVPSNNYIIPN
KSEELEARFAGIDDYTYSSGDVKALKSNRKKYSGKTPHLLLMLLPSYRLESQQPSRRKKR
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYHANFCAGACPYLWSSDTQHSR
VLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcactgctatctcctgagcgtgctcctcaccgtggatctggccaccgtggctctcagc
ctgtctacctgcagcaccctcgacatggatcagtttatgcgcaagaggatcgaggcaatc
cgggggcagatcttgagcaaactgaagctcaccagccccccggacgagtaccccgagccc
gaggaggtgcccccggaggtcatctccatctacaacagcaccagggacctgctgcaggag
aaagccaaccacagagccgccacttgcgagagggagaggagcgacgaggagtattatgcc
aaagaagtttacaaaatagacatgcagcctttttaccccgaaaacgccatcccgccgagc
tattacagcctttacttccggatcgtcagatttgacgtctcagcgatggagaagaacgcc
tccaacttggtgaaggctgagttcagggtcttccgcctgcagaactccaaggcgcgcgtc
tcggagcagcggatagagctgtaccaggttttaaaatctaaagaattatcatcaccagga
cagcgctatattgacagcaaagtagttaaaacaagagctgaaggagaatggctgtctttt
gatgtcactgaggctgtacacgagtggctccatcacagagacaggaatcttggatttaag
ataagcttacattgtccgtgctgtaccttcgtgccttccaataattatatcatcccaaat
aaaagtgaggagcttgaagcaagatttgcaggtattgatgactacacatattccagtggt
gatgtgaaagctttaaagtccaataggaaaaaatacagtgggaagaccccacatcttctg
ctaatgttgttaccctcctacagacttgagtcgcaacagcccagtcggcggaagaagcgt
gctctagatgctgcctattgttttaggaatgtgcaggataattgctgtctgcgtccactt
tatattgacttcaagagggatcttggctggaaatggattcatgaacctaaaggataccat
gctaatttctgtgcaggagcctgcccctatttatggagctcagatactcagcacagcaga
gtactcagcttgtataacaccataaatccagaagcttctgcctctccatgctgtgtgtcc
caggatttggaacccctcaccatcctctattacattggaaaaacacccaaaatcgaacag
ctgtccaacatgattgtaaagtcttgcaagtgcagctag

DBGET integrated database retrieval system