KEGG   Corvus cornix (hooded crow): 104685827
Entry
104685827         CDS       T03546                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ccw  Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccw03000]
    104685827 (AHRR)
Transcription factors [BR:ccw03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    104685827 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_11 PAS_9 DUF1505 PglZ Rotamase_3
Other DBs
NCBI-GeneID: 104685827
NCBI-ProteinID: XP_010392170
Position
Unknown
AA seq 759 aa
MIPPGECLYAGRKRRKPIQKQRPAVGNEKSNPSKRHRDRLNAELDHLASLLPFPPDIVSK
LDKLSVLRLSVSYLRVKSFFQAIQEKHFKKQVGQTTKEDNISNKTAVQEGGLLLESLNGF
ALVVSADGMIFYASSTIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMNPPHMLS
GQQLQSETGEEYILSKLFKAQENDSMTTDYSSFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQRKKSSSGTVLPPQLSLFCIVVPLLLPSVTEMKMKSLLVKAKHKADDAAAANTN
SSSKSSSGPCEATELYERNSHHEGAAFTNALQTAENQIKAKNNGENGISLVKVQTNEDHW
VWVQANTQLLYRSGCSEYVLAQQQMLKEEDEQLKILSGFASLKGNLEGLSYNSAIETLGQ
WKHLNWAAVKNEQDNVKVKFEPHTNGECFMQEEPLSSNTSVLGIQNNCTTNSSWTLRNSS
SCSMSQRMNTCPNRRAGSFYNRDQNFLNLASTCSSHWGSTENGQSYLGLQQRCAENYATD
HLKLQRPLISSESLYDTAVPLEMPIKTEYDSDSENIADNYLLSQSRAWLDESGSVRKQVS
SYPNRMYLKTEPDLCEPALPCQKPRHCLYTPHNWQCIIANHPNNLNLNRACKGSRNKEVA
PFCPQNASVCLESMPDLPHTACYSHFYSPSPGEEKEQINEVFKVPCEFKNPCLVQAIKRE
PLDSPPLSNSGQNRVHASFPENTLAGPVPHKTTECTFLQ
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgattcctccgggggaatgcctatatgctgggaggaaaaggaggaaacccattcagaaa
caaaggccagcagttgggaatgaaaaatcaaatccttcgaagaggcacagagaccgtctg
aatgcagaactggaccacctggccagcctcctcccttttccacccgacatcgtatcgaag
ctggacaaactttcagtcttgcgccttagtgtcagctatctccgagtcaaaagtttcttt
caagccattcaagaaaagcactttaagaagcaagttggccaaacgacaaaagaagacaat
atatctaacaagactgctgtacaagaaggtggacttctactagaatcactgaatggtttt
gccttggtggtgagcgcagatggaatgatattctatgcgtcatcaacaattgtggactac
ctagggtttcatcagactgatgtaatgcaccaaaacatatatgattacattcacgtggat
gatcgccaggatttctgtagacaactgcactgggccatgaatcctccccacatgttgtct
ggacagcaactacagtcagaaacaggagaagaatatattctcagtaaattgtttaaagca
caagaaaatgacagcatgacaacagattactcttcctttttaactcgctgtttcatctgt
cgagttcgctgcttgttggacagtacttctggattccttacaatgcagttccaaggcaaa
ctaaagtttctctttggacaaaggaagaagtcctcatcaggaacagtattgccacctcag
ctgtccttattctgcatagtggtaccacttttgctcccttctgtgacagagatgaagatg
aaaagcctgcttgtgaaagcaaaacacaaagctgatgatgcagcagcagcgaacaccaac
tccagttcaaaaagcagttcaggaccatgtgaagcaacagaattatatgaacgaaacagt
caccatgaaggtgccgccttcactaatgcattacagactgctgaaaaccaaatcaaagca
aagaataatggagaaaatggcatttctttagtcaaagtacaaacaaatgaagatcactgg
gtctgggttcaagctaacactcaacttctgtatcgaagtggttgttcagaatacgtcctt
gcccaacagcaaatgctaaaggaagaagatgaacaactgaagatactaagtggttttgcc
agtttgaaaggaaacctggaggggctttcctataatagtgccattgaaactctgggccag
tggaagcatcttaactgggcagcagtgaaaaatgaacaagataacgtaaaagtgaagttt
gagcctcatactaatggtgagtgttttatgcaagaggaacctctcagttctaacacatca
gttttaggcattcaaaacaactgcaccacaaacagtagctggactttaagaaactcgagt
tcttgttctatgagccagcgaatgaacacttgtccaaacaggagagctggatcattctac
aatagagaccaaaatttcttaaatttggcatcaacttgttcttcccactgggggagcaca
gaaaatggccagtcttacttggggctccaacaacgctgtgcagagaactatgcaacagac
cacctgaagctgcagagaccattaatatcctcagagtctctctatgacactgctgttccc
ttggagatgcctatcaaaacagaatacgattctgattctgaaaacattgctgataactac
ctgctgtcgcagagccgagcctggctggatgagagtggctcagtgagaaagcaggtgtcc
agctatcccaacagaatgtacctcaaaacagaaccggacctctgcgagccagccctgcct
tgccagaagccaaggcactgcctttacacaccacataattggcaatgcatcatagcaaat
catcccaacaacctgaacttgaacagagcttgcaagggttcacggaacaaggaggtggcc
ccattctgccctcagaacgcctccgtgtgtttggaaagcatgcccgacctgccacacaca
gcttgctacagccacttctacagccccagcccaggggaggagaaagagcagattaatgag
gtgttcaaagtgccatgtgaatttaaaaacccctgcttggttcaagcaatcaagcgtgag
cccctggattctccaccgttgtccaacagtggacagaacagagtacacgcgagctttcct
gaaaatacattagcaggtcctgtgcctcataaaaccactgaatgtacatttttgcaatag

DBGET integrated database retrieval system