KEGG   Corvus cornix (hooded crow): 104686307
Entry
104686307         CDS       T03546                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
ccw  Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ccw03021]
    104686307 (AFF3)
Transcription machinery [BR:ccw03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     104686307 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 104686307
NCBI-ProteinID: XP_020439184
Position
Unknown
AA seq 1144 aa
MGHPRVPGKEEEEEENEEEEEESGKNPPRTQLRRAKPRHRGQKWAVHCSVLRAGYLSVYE
PDRNVLRRKEWERRNQEAQQDNGAFNTSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKD
LLTDRSNQSHLVGVPKPGVPQTPLPKPDEHLTADSRPPPPPPISSTTSSTPASLAAQQSK
STTMGWQKAGHNGASEGQQRASKHGHRSLESHKGDFKLANQKSNLEKLKRYASSPTSSSS
SSSSSSSSSSSSSSSSSFSSSSSSSSTSSSSSSSNTAQQSSLRATLGDNVNRVQQPAKLS
CSSEGGTQVQERPAKHGGAHCVQNFPPSLASKPSLGQQKPTAYVRPMDGQDQAPDESPKL
KLPAETTKSYRGVPSSRPDSARTKSKITKFSIPKQEEDSGTGDNSCIEEILREMTHSWPP
PLSAIHTPGKAEQSKFPFPNKESQQGSTGHSNTRKSDVEPKTPEKSATHTSMLEDDLKLS
SDEEENDQQAAQRSALRVLSDSLVVPQSNARASGLSSKGSSSSSSSESETSSESDSESES
SSSESDGSKPSHYSTPEPEPPSSNKWQLDKWLNKVTPHKAPILTHHDGPALEAHPYYGRV
KAERQEGEKTPAEGPAEHRSGESRTAAAAGTGTPSKPHGGCSAFGSINARTSSEIAKELE
EQFYTLVPFGRNELLSPLKDSDEVKSLWVNIDLALLSRIPERLPEEPLAMSAGANQAASL
PQASSAEPPAEKGLPKSRRKRKCENEEECRDIKKTHLERESSSRLAASAQSITTANHCNM
NENSLAIPINKNEKMLRSPVSPLSDASKHKYSNDDLTSSSRPNGSSLLPSISSSKKHKGE
IQSQLHPGDFNKAIHINSENVLLCNKPQFQTEPWSPLSTTPRDCRRTKLIFDDIPRNADY
FMQEAKRKKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELI
RYAVRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIEYFKNSSK
AAQNPSPWGASGKSTGTPSPMSPSPSPVSSVGSQGSTGAPSPSPIISIPQRIHQMAANHV
SITNSILHSYDYWEMADNLAKENRDFFNDLDALMGPITLHSSMEHLVQYTQQGLHWVRNS
AHLS
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgggccaccccagggtacctggcaaggaggaggaggaggaggaaaacgaagaggaggag
gaagagagcggaaaaaacccaccccgaacccaacttcggcgggccaaaccccgccaccgg
ggtcaaaagtgggctgtccattgctctgttctccgagctggctatttgagtgtctatgag
ccagatagaaacgtgctgcgaaggaaagaatgggaaaggagaaatcaggaggcccagcag
gacaatggcgcgtttaacacgagctattccctcttcagtgaaccgtacaagactaacaag
ggggatgagctttccaatcgcatccagaataccttgggcaactatgatgaaatgaaggac
ttgttaactgaccggtcaaaccagagccatcttgttggggttccaaaacctggggttcct
cagacacctctccccaagcctgatgaacatcttaccgcagactcgagaccaccacctcct
cctcccatttccagcactacttcttccacaccagcatctctagctgcccagcagagcaaa
agtaccacaatgggctggcagaaggccgggcataatggcgcttcagaaggccagcagaga
gcaagcaaacacggacaccggtcgctggagtcacacaagggtgacttcaaactggcaaac
caaaaatccaatttggagaaactaaaacgctatgcatcaagtcccacctcctcctcctcc
tcctcttcttcttcctcctcttcctcctcctcctcctcctcctcctcctccttctcctcc
tcctcctcttcctcctccacctcttcttcctcctcctcctccaatactgcccagcaaagc
tcgctgagggccacattaggagacaacgtcaatagagtgcagcagccagcaaagctcagt
tgtagctcagaaggaggaactcaagtccaagagaggccagcaaagcatggtggggcacac
tgcgtccaaaacttcccaccctcccttgcttcaaagcccagtctgggtcagcagaagcca
acagcttatgtaaggccaatggatggtcaagaccaggctcctgatgagtctccaaagctg
aagttaccagcagagacgaccaagtcgtataggggagtgccttccagcaggcctgattcg
gccaggaccaagtcaaagatcaccaagttcagcattcctaagcaagaagaagacagtgga
acaggagataacagctgcattgaagaaatattgcgggagatgacccattcatggcctccg
ccactgtcagctattcacacaccaggaaaggcagaacaaagcaagtttcccttcccaaac
aaggagtcacaacagggatccacaggacacagcaatacaaggaaaagtgatgtagagcca
aagaccccagagaaaagcgcaacccatacatcaatgctagaagatgacctgaagttaagc
agtgatgaagaggagaatgaccagcaggcagcacagagatctgctctccgcgttctatct
gacagcctggtggtgccacagtccaacgcccgagcctcgggactctccagcaaggggtcg
agcagcagcagctccagtgaatcggagaccagctcggagtctgactcagagagcgaaagc
agctccagcgagagtgacggaagcaaaccctcgcattactccaccccagagcctgagccg
ccctcgtccaacaagtggcagctggacaagtggctgaacaaagttacccctcacaaagca
cccatcctaacccaccacgatggcccggcgctggaagcccatccctactacggccgcgtg
aaggcagagcggcaggaaggagagaagaccccggctgagggcccggccgagcaccgcagt
ggggagagccgcacggccgccgccgccgggaccggcacccccagcaaaccccacggcggc
tgcagtgcctttggctctattaatgccagaactagtagtgaaatagcaaaggagctggag
gaacagttttacaccctggttcctttcggtaggaatgagctcctgtctcctctgaaagac
agtgatgaggtaaagtcgctgtgggtcaacattgacttggctcttttgtccaggattcca
gagcgtttgcccgaagaaccgctggccatgagcgccggagcaaaccaggcggccagcctc
ccgcaggctagtagtgctgaaccccccgcagagaagggtttaccgaaatctagaaggaaa
cgcaagtgtgagaatgaggaagagtgcagagacatcaagaagactcacttagagcgagag
agctcttcacgattagctgcctctgcccaaagcatcacaacagcaaatcactgcaatatg
aatgaaaatagcttggcaataccaataaataaaaatgagaaaatgcttcggtcacccgtc
tctcccctctctgatgcatcaaaacacaaatattccaacgatgatttaacttcctccagc
agacctaatggcagcagtctattaccttccatctcctccagcaaaaaacataagggtgaa
atccagtcacagctacatcccggagatttcaataaagcaattcacatcaattcagaaaac
gttcttctgtgcaataagccacagttccaaacagagccttggtcacctctgtccaccaca
cccagggactgcagaagaacaaagcttatcttcgatgatataccacgcaatgcagattac
tttatgcaggaagctaaacggaagaagcataaagcagatgcaatggtggagaagtttgga
aaggcactgaattatgcagaagcagcactatcttttattgagtgtggaaatgcaatggaa
caaggtccaatggaatctaagtccccttataccatgtattcagaaacagttgaactgatc
aggtatgcagtgagactaaaaacccactcaggccccaacgccacgccagaagacaaacag
ctggcagcattatgttaccgctgcctggcccttctgtactggaggatgttccgactcaag
agagaccacgcagtcaagtattcaaaagcgcttattgagtatttcaagaattcatcaaaa
gctgcccagaacccatctccttggggtgccagtggaaagagcacaggaactccatcacct
atgtcccctagcccttctccagtcagttctgtaggatcccaggggagcacaggagcccct
tccccatctcctatcatcagcatcccgcagcgcattcatcagatggccgccaaccatgtc
agcatcaccaacagcattctgcacagctatgactactgggagatggctgacaacctggcc
aaggaaaacagagacttttttaacgacttggacgcattgatgggacctatcaccttgcac
agcagtatggagcatttagttcagtacactcaacaaggacttcactgggtgcggaatagc
gctcacttgtcataa

DBGET integrated database retrieval system