KEGG   Corvus cornix (hooded crow): 104686389Help
Entry
104686389         CDS       T03546                                 

Definition
(RefSeq) 7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00120  Primary bile acid biosynthesis
ccw01100  Metabolic pathways
ccw03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    104686389
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    104686389
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ccw00199]
    104686389
Enzymes [BR:ccw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     104686389
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     104686389
Cytochrome P450 [BR:ccw00199]
 Cytochrome P450, animal type
  CYP8 family
   104686389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 104686389
NCBI-ProteinID: XP_010393071
Position
Unknown
AA seq 509 aa AA seqDB search
MVLWVILLCTLVSSLLGGLYVLGVFRRQRPNEPPLEKGTIPWLGYLLEFRKDSSEFLKRM
QRKYGDVFTVLIGGYYFTFVMDPFCFGTIVKESRSKLDFRTSAIQLVMQVFGYKATEATH
SIVHTSSTKHLMGDGLTVLTQATMESFRKLLLFNLSSGEKRVWQEENLFHYCYNIVFRAG
YLALYGTEPSRGAGNKEEAEEQDRLHSNQLFQEFRKYDRLFPHLAFAMLPPKDKREAERL
KRHFWNVLSVKKAWQKDNISGWISDQDQLLSENGVPEYMRDRFMFMLLWASQGNTGPTAF
WLLLYLLKHPEALKAVRDEVDKVSRESGQEMKAGSPTVTVTRDMLNQTPLLDSALEETLR
LVAAPMLVRAVLEDTSLRTSSGTEFTLRRGDRLALFPHISVQMNPEIHEEPHKFKYDRFV
NPDGTKKDFYRNGKKLKFVNMPWGAGVSTCPGRFFATAEMKLFVFLMLSHFDLELVNEEE
EIPAIDISRWGFGTMQPVHDVRFRYRPRF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgtgggtgattctcctctgtaccttggtgtcatcgctgctcggtgggctctat
gtcctgggtgtatttcggagacagagacccaatgagccgcccctggagaaaggtaccatt
ccctggctgggctacctgctggaattcagaaaggacagctcagagtttctcaaaaggatg
cagaggaaatacggggatgttttcacggtgctgatcggtggctattacttcaccttcgtg
atggatcccttctgctttggcaccatcgtgaaggaatcacgatctaaactggactttagg
acttctgcaattcagttggtcatgcaggtttttggctacaaggccaccgaagccactcat
agcatagttcatacctcgagcacaaagcacctgatgggagatggcctcactgtcctcaca
caagccaccatggagagctttcggaagctgctgctcttcaacctgagctcaggagagaag
cgagtgtggcaggaggaaaacctcttccactactgctacaacattgtcttcagggccggg
tacctggctctgtatggcaccgagccatcccgaggggcagggaacaaggaggaagctgaa
gagcaggatcgcctccactccaaccagctcttccaggaatttcggaagtacgaccgcctc
tttcctcacctggcctttgctatgttgcctcccaaggacaaaagagaagctgagcggctg
aagagacacttctggaacgtgctgtctgtgaagaaggcctggcagaaggacaatatcagt
ggctggataagcgatcaagaccagcttctgtcagaaaatggtgtccccgagtacatgcgg
gatcgtttcatgttcatgctcctctgggcatcccaaggcaacacgggcccaactgcattc
tggctcctcttgtatctgctgaaacatccagaggctctgaaggctgtgagagatgaggtg
gataaagtctcgagggagagtgggcaggagatgaaggcagggagccccacagttaccgtc
actagggacatgctgaaccagactcccctgctggacagtgccttggaggagaccctgagg
ctagtggcggccccgatgctggtcagagctgtcctcgaggacaccagcctgaggacaagc
agtggaacagagttcaccctccgcaggggagacaggttggctctgttcccacacatctct
gtgcagatgaacccagaaatccatgaggagcctcacaaatttaagtatgaccgattcgta
aacccagatggcaccaagaaggatttctacagaaatgggaagaagctgaaatttgtcaac
atgccatggggggcaggagtttccacctgtcctgggaggttctttgccacagctgaaatg
aaactgtttgtgttcttgatgctgagtcactttgacctggagctggtcaatgaggaggag
gagatcccagccatagacatcagccgctggggattcgggacgatgcagcctgtccacgac
gttcgcttcagataccggccacgcttttaa

DBGET integrated database retrieval system