KEGG   Corvus cornix (hooded crow): 104687151
Entry
104687151         CDS       T03546                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5 isoform X1
  KO
K16522  A-kinase anchor protein 5
Organism
ccw  Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccw01009]
    104687151 (AKAP5)
Protein phosphatases and associated proteins [BR:ccw01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     104687151 (AKAP5)
SSDB
Motif
Pfam: Plasmodium_HRP
Other DBs
NCBI-GeneID: 104687151
NCBI-ProteinID: XP_019148957
Position
Unknown
AA seq 795 aa
MVKAAKEIQMENPREAETPSTGATCSPPEEQAEKPSMLCFKKRKKSCKKGLTVKDVCEGT
SEEKSQCVSADQEEAKPSKPSQSSKGTWAAIKNLTRPRRRQKSSSRKKVPSDSQVQLEVD
AEESCAQDLPKKRASSGVKMPCVRFSRGKKKSSPSEAVEESEGSGQANEVMGVLNKASEE
PEDLAPTDKSESFSPVSAEEEEQDTVKQEQHRMKEDQDTMKEEQDTVKEDKDIVKEDQDT
AKESDTSVGKSEPLTEPTPDAEEHLECTVQSEITDSETVDETAQDKLQEGSLPQTTDNAE
GREGAPEVPVSKDQPDNVPEITERQEIPNICKEMPERDELEKSINLPEECKAEETVTDFS
ELASGGDAASVQETASVKDAASVKDATSVQEAVNVQEAASVKDDAVSVKDTVSVKDTASV
QDATSVQDAASVQEAANVQDATSVKDTVGVQDAVSAQDAAGRKDAASAQEAASVQDAVSV
KHAVSAQEAVSVQEAVSVKDAVNAQEAASAQEAVSAQEAVSAQEAVSVQEAVSAQEAVSA
QEAVSVQEAVSVKDAVSVKDAVSVQDAVSAQEAVSVKDAVSAQEAVSVQEAVSAQEAVSV
QEAVSVKDAVSVKDAVSVQDAVSAQEAVSVKDAVSAQEAVSVKDAASVQEEASVKEPVSV
LEAASVQECSSHQVLEANAGAGVSIIITITEAEDSDNTDSDQAYEPSPVLHQKRQKGNKK
SNRNADVGQKEGPEAGGGPQAEEKGLGDQGHRTGEQYELLLIETASSLVKAAIQSSIEQL
VNEMALEQNKHNSFL
NT seq 2388 nt   +upstreamnt  +downstreamnt
atggtgaaggcagctaaggaaattcaaatggagaacccaagagaggcagagactcccagc
acaggggccacatgttccccaccagaggaacaagcagaaaaaccctccatgctttgtttt
aagaagcggaagaagtcctgtaagaaggggctgactgtgaaggatgtgtgtgaaggcacc
tcagaggagaaaagccagtgtgtcagtgctgaccaagaggaggcaaaaccttccaaacca
tcacaatcctccaaaggaacctgggcagccatcaaaaaccttaccagacctcggagaagg
cagaaatcgtcctcacggaagaaggtgccctctgattcccaagtgcagctggaggtggat
gctgaggagagctgtgcacaagacctcccaaagaaacgggcaagctctggggtgaagatg
ccctgcgtgaggttctccagaggcaagaaaaaatccagcccctcggaagcagtggaggag
tcagagggcagtggtcaagcaaatgaagtgatgggtgttttgaataaggctagtgaagag
ccagaggatttggccccgacggacaaatctgaatccttcagcccagtctctgcagaggag
gaggagcaggatacggtgaagcaggagcagcatagaatgaaagaggaccaggatacaatg
aaagaggagcaggatacagtgaaggaggataaggatatagtgaaggaggaccaggataca
gcaaaagaaagtgacacctctgttgggaagagtgagcccttgacagagcccacacctgat
gcagaggaacatttggagtgcaccgttcagtcggagataaccgattcagagacagttgat
gaaacagcccaggacaaactgcaggaaggaagcctaccccaaaccaccgacaatgcggag
ggcagggaaggtgctcctgaagtgcctgtttccaaagatcaacctgacaatgtccctgaa
atcacagagcggcaggaaatccccaatatctgcaaagagatgcctgaaagggatgaattg
gaaaagagcataaatcttcctgaggagtgcaaagccgaggagactgtaactgatttcagt
gagttggcatctggaggtgatgcagcaagtgtacaggagacagcaagcgtgaaggatgcg
gcgagtgtgaaggatgccacaagtgtgcaagaggcagtgaatgtgcaggaggcagcaagt
gtgaaggatgatgcagtgagtgtgaaggatacagtgagtgtgaaggatacagcaagtgtg
caggatgccacaagtgtgcaggatgcagcaagtgtgcaagaggcagcgaatgtgcaggat
gcaacaagtgtgaaggatacagtgggtgtgcaggatgcagtgagtgcacaggatgcagca
ggcaggaaggatgcagcaagtgcccaagaggcagcaagtgtgcaggatgcagtgagtgtg
aagcatgcagtgagtgcccaagaggcagtgagtgtgcaggaagcagtgagcgtgaaggat
gcagtgaatgcacaggaggcagcgagtgcacaggaggcagtgagtgcacaggaggcagtg
agtgcacaagaggcagtgagtgtgcaggaggcagtgagtgcacaagaggcagtgagtgca
caagaggcagtgagtgtgcaggaggcagtgagcgtgaaggatgcagtgagcgtgaaggat
gcagtgagcgtgcaggatgcagtgagtgcacaggaggcagtgagtgtgaaggatgcagtg
agtgcacaagaggcagtgagtgtgcaggaggcagtgagtgcacaagaggcagtgagtgtg
caggaggcagtgagtgtgaaggatgcagtgagtgtgaaggatgcagtgagcgtgcaggat
gcagtgagtgcacaggaggcagtgagtgtgaaggatgcagtgagtgcacaagaggcagtg
agtgtgaaggatgcagcaagtgtgcaggaggaagcaagtgtgaaggagccagtgagtgtg
ctggaggcagcaagcgtgcaggaatgctccagccatcaggtactagaagcaaatgctggt
gctggtgtcagcatcatcatcaccatcactgaagctgaggactctgacaacaccgactct
gaccaggcctatgagccgtccccagttttgcaccaaaaaaggcaaaaagggaataaaaaa
tcgaacaggaatgctgatgttggtcaaaaagagggccccgaggctggtggcggtccccag
gcagaggagaaaggtctgggtgaccaggggcacagaactggggagcagtacgaattgctc
ctcatagaaaccgcctcttccctcgtgaaggcggccattcagtcatccatagagcagctg
gtcaacgaaatggccctggaacagaataaacacaacagctttctgtga

DBGET integrated database retrieval system