KEGG   Corvus cornix (hooded crow): 104688231Help
Entry
104688231         CDS       T03546                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00564  Glycerophospholipid metabolism
ccw00565  Ether lipid metabolism
ccw00590  Arachidonic acid metabolism
ccw00591  Linoleic acid metabolism
ccw00592  alpha-Linolenic acid metabolism
ccw01100  Metabolic pathways
ccw04010  MAPK signaling pathway
ccw04217  Necroptosis
ccw04270  Vascular smooth muscle contraction
ccw04370  VEGF signaling pathway
ccw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104688231
   00565 Ether lipid metabolism
    104688231
   00590 Arachidonic acid metabolism
    104688231
   00591 Linoleic acid metabolism
    104688231
   00592 alpha-Linolenic acid metabolism
    104688231
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104688231
   04370 VEGF signaling pathway
    104688231
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104688231
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104688231
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104688231
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     104688231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 104688231
NCBI-ProteinID: XP_010395924
Position
Unknown
AA seq 992 aa AA seqDB search
MRTQTVLLGIHPANMSWEVLPVEVPGADTENVSLEPLPTEVPRVDPENISLELLPVEMPG
VDPESMSKGFLPMEEPGVYPENMSKGFLPMEEPGVYPENMSKGFLPMEEPGVYPENMSKG
FLPMEEPGVYPENMSKGFLPMEVPETLYYMKSGKTMMPSDALEDENSGFDPLGDGEQQKR
RDDSTVPDQGDFKIESSPCFLLTVRIIRMRNLQRVDALSQADCYVSLWLPTATCERSRTK
TVRNSDNPVWNETFYFRIQSQVKNVLELTVYDEDFATPDDHLLCALFDTAKLPLERTVIL
YFKPSPNAKEELEVEFKLEVASGPHETIATNGVLVCRELCCLEVEVAEKTMQKSKKELSL
TVKGSFEGTQDIVLGPNGVVSPSCPTEFHYIKYAEPTLDVMLPKKRHYHPWSCRYSTETG
SPVVMLNSLPMGRKTTIAEEKRFDLNVTAKTCNCSCHQDLDMRFGFNLCSEEMDFLGKRK
RYVASALKNVFHLPCDLQDQEVPVVAIITTGGGLKSMTGLYGSLMGLKKLNLLDCVTYIS
GLSGTTWTMANLYRDAYWSQKDLDSHIGEAQKQATKCKMGCFSMDRMKYYNKQLCQRKEE
GYRTSFIDLWGLMIEYLLNDGKDPHKLSEQQEALCDGQNPLPIYVSVCVRDSYSTNDFKE
WVEFTPYEVGLLKYGAFIRTEHFGSEFFMGRLLKKLPESRICYLQGMWSSIFSVNLLQIW
GLSHSSEDFWKRWTQDRIEEVDEDPVLPTRPHELRTRMYTPPGPLSSALRGALTDRFSVA
QHHNFLKGYQLHNNYMENQHFCRWKDTVLDTRPNQLMQNSDHLGMIDAGFFINTSSAPLL
RPQREVDVIIYLSYTTGSHTSSLDKACKYYSEQKIPFPTISLTDEDKKNLKECYIFQDSD
LPGCPIVIFLPLVNDTFQEYKAPGVKRCCSEMEEGQLDLTSRCSPYCMFSVRYTDENYRK
LLNLSEYNILNNSQMIMQALQTAMQRRRQKMC
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcagacagtcctactgggaatacatcctgcaaacatgtcttgggaagtgctg
ccagtggaggtaccaggagcagatactgaaaatgtgtctctagaaccgctgcctacagag
gtgccacgagtagatcctgaaaatatatctctcgaattgctgcccgtggagatgccagga
gtagatcctgaaagcatgtctaaaggattcctgcccatggaggagccaggagtatatcct
gaaaacatgtctaaaggattcctgcccatggaggagccaggagtatatcctgaaaacatg
tctaaaggattcctgcccatggaggagccaggagtatatcctgaaaacatgtctaaagga
ttcctgcccatggaggagccaggagtatatcctgaaaacatgtctaaaggattcctgccc
atggaggtgccagaaacactctattacatgaaatcagggaagaccatgatgccatcagat
gcactagaggatgaaaactcaggcttcgatcccttgggagatggtgaacagcaaaaaagg
agagatgacagtactgtgccagaccaaggtgatttcaagatagaatcctctccttgcttc
ctgttgaccgtaaggatcatccggatgagaaatctccagcgagtagatgccttaagccag
gctgattgctacgtgtccttgtggctgccaactgcgacgtgtgaaaggtcacgcactaaa
actgtgagaaactccgacaatccagtgtggaacgaaaccttctacttcagaatccagagc
caggtcaagaatgtgctggagctcacagtgtatgatgaggattttgctactccagatgac
catctcctctgtgcactctttgatactgctaaacttccacttgaaaggacagtgatcctg
tacttcaagcctagcccaaatgccaaggaggagctagaggttgaattcaaattggaggtc
gcatctggtcctcatgaaacaattgctaccaatggagtgctggtgtgtcgtgaactttgc
tgcttggaagttgaagtggcagagaagacgatgcaaaaatcaaagaaagagctttccctc
actgtgaagggctcctttgaggggacacaggatattgtgctgggccccaatggagtcgtc
agcccgtcatgtcccaccgagttccactacatcaagtatgcggagccaacgctggatgtg
atgctgccaaagaagaggcactaccacccttggtcctgtaggtatagtacagagacaggc
tccccagtcgtgatgctgaactcgctgcccatgggaaggaaaacgaccattgcagaggag
aaaagatttgatttgaatgtgacagcaaaaacttgcaattgttcatgccaccaagacctg
gacatgcgcttcgggtttaacttatgttctgaagagatggatttcctggggaaaagaaag
agatatgtagccagtgctctcaaaaatgtttttcacctaccatgcgatctgcaggatcaa
gaagtccctgttgtggctatcatcacgacaggtggaggactgaagtcaatgacaggattg
tatggcagcctcatgggactcaagaagttaaatctcctggactgtgtaacatacatcagc
gggctgtccggcaccacatggaccatggccaacttatacagagatgcctactggtcacag
aaggacctggactcacatattggtgaagcccagaaacaagcaacgaagtgcaagatgggc
tgtttctcaatggatcgcatgaagtactacaacaagcagctttgccagaggaaagaagag
ggatacaggacatcatttatagacctttggggtctcatgattgagtacttactgaatgat
gggaaagacccccacaagctttcagagcagcaagaagcactgtgtgatggccagaaccca
ctgcccatctatgtgtcagtctgcgtcagggacagttacagcaccaatgatttcaaagag
tgggtggagttcactccctacgaggtgggacttctgaagtacggcgcgttcattcgcacg
gagcacttcggaagcgagttcttcatgggccgcttgttgaaaaagctccccgaatcccgc
atctgctaccttcaaggtatgtggagcagtatattttcggtgaacctgttacaaatatgg
ggactgtcgcacagttctgaggacttctggaagagatggacacaagacagaatagaagaa
gttgatgaagacccagtgttgcccacaagaccccacgagctgaggactcgcatgtacacc
ccccctggccccctgtccagcgcccttcggggagcactgaccgaccgcttctccgtcgcc
cagcaccacaatttcctgaagggctaccagctgcataacaactacatggagaaccagcac
ttctgtcggtggaaagacactgtgttagacacacgtcccaaccagctaatgcaaaattct
gatcacctgggcatgatagatgctggatttttcatcaataccagcagtgcaccacttcta
aggccacagagggaagtggatgtcatcatatatctaagttatactactggatcacataca
tcgtctctagataaggcatgtaaatactactcagaacagaaaatccccttcccaacaatt
tctttgactgatgaagataagaaaaatctgaaggagtgctacattttccaagattcagat
ttgccaggatgtccgattgtaatttttcttccccttgtgaatgataccttccaagagtac
aaagcacctggtgtcaagcgctgttgctcagagatggaggaaggccaacttgatttgacc
agccgctgttccccatactgcatgttctcagtcaggtacaccgatgagaactaccgcaag
ctgctgaatctcagcgagtacaacatcctcaacaactctcagatgattatgcaggccttg
cagacagcgatgcaaaggagaaggcagaaaatgtgctga

DBGET integrated database retrieval system