KEGG   Corvus cornix (hooded crow): 104689701
Entry
104689701         CDS       T03546                                 

Definition
(RefSeq) deoxycytidine kinase 2 isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00230  Purine metabolism
ccw00240  Pyrimidine metabolism
ccw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104689701
   00240 Pyrimidine metabolism
    104689701
Enzymes [BR:ccw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     104689701
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin
Other DBs
NCBI-GeneID: 104689701
NCBI-ProteinID: XP_039415337
Position
13
AA seq 367 aa
MSTPAKRHCQSPAGSLESSFQKRLRKVSIEGNIAAGKSTFVRLLEKHSDEWEVIPEPIAK
WCNIQTAEDEYEELSTSQKSGGNLLQMLYDKPTRWAYTFQTYACLSRVKAQLKPVSAKLH
EAEHPVQFFERSVYSDRYVFASNLFESGNINETEWSIYQDWHTWLLNQFQSDIELDGMIY
LRTTPQKCMERLQMRGRHEEQGIELEYLENLHYKHETWLHERTMRVDFENIKKIPILVLD
VNEEFKNNKIKQEYLIDKVSIKRRGICICFSSAVIMHAVTPPEVGGRVNNHLRKQGGNTE
VTSVKTMFTSSKERQDLGSKCQKKFLWSCLASPWEKKHLLLIPKCMRKCSPSKPYKPFSS
SCSGSSI
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtccaccccggccaagaggcactgccagagcccagccggctccctcgaatccagcttc
cagaagcgcctcaggaaggtttccatcgaggggaacatcgctgcggggaagtcaacgttt
gtcaggctgctggagaaacacagcgatgagtgggaggtcatccccgagcccatcgctaag
tggtgcaacatccagacagctgaggatgagtatgaggaactttcaacatctcagaagagt
ggaggaaacttacttcaaatgctgtatgacaaacccacaagatgggcatacacatttcag
acttatgcttgcttgagccgagtaaaagcacaattaaaacctgtctcagccaagctacac
gaagcagaacatccagtgcagtttttcgagagatctgtgtacagtgacagatacgtattt
gcttctaacctgttcgagtctggaaacattaatgaaacagagtggtctatttatcaggac
tggcacacatggcttttgaatcagtttcaatcagatatagaactggatggcatgatctat
ctcagaaccacacctcagaaatgcatggaaaggctacagatgaggggaagacatgaggag
caaggaattgagcttgagtatttggaaaacctccactataaacatgaaacctggcttcat
gaacggactatgagagttgattttgagaacattaagaagattcctattctagttttggat
gttaatgaagagtttaagaacaataaaattaaacaggagtacctaattgataaagtaagt
atcaaacgtcgggggatttgtatctgcttttcttctgcagttatcatgcatgcagtgaca
cctccagaggtgggagggagagtaaacaaccatttaaggaaacaaggtggtaatacagag
gtcacttcagtcaaaacgatgtttaccagttccaaggaaaggcaagacttaggaagtaaa
tgtcaaaagaaattcttatggagttgtttggccagtccatgggaaaaaaaacacctcctc
ctaatacctaaatgcatgaggaagtgctctcctagcaaaccctataaaccattttcttca
tcttgctctgggtcatcaatttga

DBGET integrated database retrieval system