KEGG   Corvus cornix (hooded crow): 104690010Help
Entry
104690010         CDS       T03546                                 

Gene name
MTMR6
Definition
(RefSeq) myotubularin-related protein 6 isoform X2
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00562  Inositol phosphate metabolism
ccw01100  Metabolic pathways
ccw04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104690010 (MTMR6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    104690010 (MTMR6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccw01009]
    104690010 (MTMR6)
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     104690010 (MTMR6)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     104690010 (MTMR6)
Protein phosphatases and associated proteins [BR:ccw01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    104690010 (MTMR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related DUF2353 Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 104690010
NCBI-ProteinID: XP_010398789
Position
Unknown
AA seq 633 aa AA seqDB search
MFCHCRPAKHCQQVGERILVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSSQRETWIL
HHHIAAVEKLPLTTSGCPLVIQCKNFRIVHFVVPRERDCHDIYNSLLQLSRTAKYEELYA
FSYNPKQNESEQVKGWQLIDLAEEYKRMGVPNAYWQLSDANRDYKICETYPRELYVPRTA
SKPIIVGSSKFRSKGRFPVLSYYHKNKEAAICRCSQPLSGFSARCLEDEHMLQAISKANP
SNRYMYVMDTRPKLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVSG
TRGLSVNDFLSGLENSGWLRHIKAVLDAAVFLAKAIAVESASVLVHCSDGWDRTSQVCSL
GALLLDSYYRTIKGFMVLIEKDWISFGHKFSDRCCQLDGDPKEISPVFTQFLESVWNLTE
QFPQAFEYNEAFLLQIHEHVHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLAEQKKYQ
NPLYNPDFSPELTLLEPNTVSFNFKFWRNMYHQFDRSMHPRQSVFNLIMNTSEQNKQLEE
DIKELEAKIKQRNGQSDVVLVKEQEQTARLSPVAQKTPPCFQKEQPPMPVNDAVRTIEGS
NRADNRYSELVSEFSKAEPAVVSLEYGVARMTC
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgttctgccactgtcgaccagcaaagcattgccagcaggtcggggaaaggatcctagta
gagcaagtgaaattactggataggttcagcacaagcaataaatcactgacgggaactctg
taccttacagcaactcatctgttattcatagattcaagccagagagagacgtggatacta
catcatcacattgctgcagtggaaaaacttcccttgactacttctggctgcccccttgtc
atccagtgcaagaacttcaggatagttcactttgttgtacccagagagagagattgccat
gacatttataactctttgcttcagctatcaagaacagcaaaatatgaagaactctatgcc
ttttcttataatccaaaacaaaatgaatctgagcaagtcaaaggttggcaacttattgat
ctagcagaagaatataagagaatgggagtgccaaatgcttactggcagttgtctgatgca
aaccgtgattacaagatttgtgaaacctatcctagagaactttatgttcccagaactgca
agcaagcccataattgttggtagctccaagttcagaagcaaaggaagattcccagtgctg
tcatattatcacaaaaataaagaggctgcaatttgcagatgcagtcaacctctctcaggt
ttcagtgccaggtgcctggaagatgagcacatgttgcaagccatcagtaaagcaaatcct
tcaaatcgctacatgtatgtgatggataccaggccgaagcttaatgcaatggctaacaga
gctgctgggaaaggctatgagaacgaagacaactactcaaacatcaggttccagtttgtt
ggcattgaaaatattcatgtaatgagatctagcttgcaaaaactgctggaagtcagtggc
acaaggggtttgtctgtcaatgactttttgtctggtctggagaattctggatggctgcgt
cacatcaaagctgtgttggatgctgctgtctttctagccaaggcaatagcagttgagagt
gcaagtgtactggtgcactgttcagatggctgggataggacttcccaagtttgttctctt
ggagctctcttgctagattcctattacagaacaatcaaaggattcatggtcttgatagag
aaagactggatctcttttgggcacaaattctctgacaggtgttgtcagttggatggtgat
ccgaaagagatctcaccagtgttcacccagtttttagaaagtgtgtggaatctgactgag
cagtttccacaagcctttgagtacaatgaagctttcctccttcaaatccatgaacacgtc
cattcatgccagtttggtaacttccttggaaactgtcaaaaagaacgagaagagctaaaa
ctaaaagagaagacctattccttgtggccgttccttttggctgaacagaagaaataccag
aatcctctgtataatccagacttttctccagaactaactcttttggagcctaatacagta
tcattcaattttaagttttggagaaatatgtaccatcagtttgatcgaagtatgcatccc
aggcagtctgtgttcaatcttatcatgaatacaagtgagcaaaataaacaactggaggaa
gacattaaagaactggaagctaaaataaagcagagaaacggccagtcagatgtggtcctt
gtgaaggagcaggaacagacggctcgtctctcccccgtggcacagaagacccctccgtgc
ttccagaaggagcagccgccgatgccagtgaatgacgccgtgcgaaccatagagggcagc
aacagagcagacaaccgctacagcgaacttgtgtccgagttctccaaagctgagcctgcc
gttgtcagcttggagtacggagtggccaggatgacctgctaa

DBGET integrated database retrieval system