KEGG   Corvus cornix (hooded crow): 104690815Help
Entry
104690815         CDS       T03546                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase-like 2 isoform X2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
ccw  Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104690815 (THNSL2)
Enzymes [BR:ccw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     104690815 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP HTH_DeoR
Motif
Other DBs
NCBI-GeneID: 104690815
NCBI-ProteinID: XP_010400395
Position
Unknown
AA seq 489 aa AA seqDB search
MEYVSTRGGARAVNFEGALLSGYAPDGGLFMPQCIPSLDRDTLRRWSSLSYPGLVKELCS
LFIPAELVPRNALHELINRAFSRFRHKDIVHLSRLKDGLNVLELWHGVTYAFKDLSLSCT
GQFLQYFLEKKQKHVNILVGTSGDTGSSAIESVRGQKNVDIFVLLPKGLCTQIQELQMTT
VVEDNVHVFAAHGNSDEIDEPIKELFADVNFAGKYNLMSLNSINWSRIMVQIAHYFYAYF
QCAPSLDTTPLPVVEIVVPTGGGGNITAGCIAQKMGLPIRLVAVVNSNDIIHRTIQHGDF
SLAESVKATLAPAMDIQEPYNVERILWLLSGSDSCQIKTLMEQFNISKRLKLPEDLHRKL
SETLGSCSASDEDIVGAMRRCWEENQYLLCPHSAVAAHYHYSQPHSIPRCCLAPASPAKF
QDAVLRANLVPQIPPEITALTAMETRSNPLERGWDWAQVLRGRIEAVAQQWEAQAGQFAP
QSRVGTPAR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgtcagcacacggggaggcgcgagggccgtgaactttgagggagcccttttg
tctggctacgcgcccgatgggggcctcttcatgccccagtgcatcccctcgctggacagg
gacaccctgcgaaggtggagcagcctctcctaccctgggctggtcaaggagctgtgctcc
ctcttcatcccggccgagctggtcccgcggaacgcactccatgagttgatcaacagggcc
ttcagcagattcagacacaaggatatcgtgcatctgtccaggctgaaagatgggctgaat
gttttggagctctggcatggtgttacttatgcatttaaggacctgtccttgtcctgcaca
gggcagtttttacagtacttcttggagaaaaagcagaagcatgtcaatattctggtgggg
acttcaggggacacagggagctcggccatcgagagtgtaagagggcagaagaacgtggac
atctttgttctgctgcccaaggggctctgcacccagatacaggaacttcagatgaccacc
gtcgttgaggacaacgtccacgtctttgctgctcatgggaacagcgatgaaatcgatgag
ccgatcaaggaactgtttgctgatgtcaattttgctggaaaatacaacctgatgagcttg
aattccatcaattggtccaggattatggtgcagattgctcactacttctatgcttacttt
cagtgtgccccatccctggataccaccccactgccagtggtggaaattgttgtgccaaca
ggaggaggaggaaatatcacagctggctgtattgcccagaagatgggtctcccaattcga
cttgttgctgtggtgaacagcaatgacatcattcataggactattcaacatggagatttc
tcactggcagagagcgtgaaggctacgttagcaccagccatggatatccaggagccttac
aatgtggagaggatcctctggctgctctcgggctctgacagctgccagataaaaacgctg
atggagcaattcaacatctcaaaaaggctgaagctgccagaggatttgcacagaaagctc
tccgagaccctgggatcatgctcggcctctgatgaggacattgtgggagccatgagacgc
tgctgggaggagaaccagtacctgctgtgcccccactctgctgtggctgctcactaccac
tactcacagccacacagcatcccccggtgttgcttggctccagcctctccagccaaattt
caggatgctgtgctccgagccaacctggttccccagatcccccctgaaatcactgcccta
acagcaatggagaccagatccaatcccctggagcggggatgggactgggcacaggtgctc
cggggccggattgaagccgtggcgcagcagtgggaggcacaggcgggtcagtttgcaccc
cagagcagggtgggaacaccggccaggtag

DBGET integrated database retrieval system