KEGG   Corvus cornix (hooded crow): 104690936Help
Entry
104690936         CDS       T03546                                 

Gene name
SUCLG1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00020  Citrate cycle (TCA cycle)
ccw00640  Propanoate metabolism
ccw01100  Metabolic pathways
ccw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104690936 (SUCLG1)
   00640 Propanoate metabolism
    104690936 (SUCLG1)
Enzymes [BR:ccw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     104690936 (SUCLG1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     104690936 (SUCLG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 104690936
NCBI-ProteinID: XP_019142918
Position
Unknown
AA seq 318 aa AA seqDB search
MSMNVQQNGVRHCSYTASRKNLYVNKNTKVICQGFTGKQGTFHSQQALDYGTNLVGGISP
GKGGKTHLGLPVFNSVKEAKEQTGASATVIYVPPPFAAAAINEAIDAEMPLVVCITEGIP
QQDMVRVKHRLLRQSKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYE
AVHQTTQVGLGQSFCIGIGGDPFNGTNFIDCLDVFLKDPHTEGIILIGEIGGNAEEDAAA
FLKENNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAGVVVSMS
PAQLGSTIYKEFEKRKLL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgaatgttcaacagaatggagtccgacactgctcctacacagcatccaggaaa
aacctgtatgttaacaaaaacacaaaggttatctgtcagggttttacaggcaaacagggc
acctttcacagccagcaggcattggactatggcaccaatctagttggaggaatttctcca
gggaaagggggaaaaactcatctaggtctgcctgtgtttaattctgtgaaggaggccaaa
gaacaaacgggtgcttcagccactgtcatctacgtccctcccccctttgctgctgctgct
atcaacgaggccatcgatgcagagatgcccctggtggtgtgcatcactgagggtatcccc
cagcaggacatggtgcgggtcaaacacaggctgctgcggcagagcaagacccggctggtg
ggccccaactgccccggagtcatcaatcctggagaatgtaaaattggtatcatgcctggt
cacattcacaagaagggaagaattggtattgtgtcaagatctggaacgctgacatacgaa
gctgttcatcaaacaacacaagttgggttggggcagtctttttgcattgggattggaggt
gatcccttcaatggaactaattttattgactgcctcgatgtcttcctgaaggatcctcat
actgaggggatcatattgattggagagattggaggaaatgctgaagaagatgcggcagca
tttttgaaagaaaataattccggccccaatgccaagccagtggtgtccttcatagccggc
ctgacggctcctccgggccggcggatgggccacgctggagccatcattgctggggggaag
gggggagccaaggagaagattgcagcccttcagagtgcaggggttgtggtcagcatgtcc
cctgctcagctgggcagcaccatctacaaggagtttgagaaaaggaaattgctgtga

DBGET integrated database retrieval system