KEGG   Corvus cornix (hooded crow): 104690945Help
Entry
104690945         CDS       T03546                                 

Gene name
HTRA2
Definition
(RefSeq) serine protease HTRA2, mitochondrial
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104690945 (HTRA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccw01002]
    104690945 (HTRA2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ccw03110]
    104690945 (HTRA2)
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     104690945 (HTRA2)
Peptidases [BR:ccw01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   104690945 (HTRA2)
Chaperones and folding catalysts [BR:ccw03110]
 Other chaperones and cochaperones
  DegP / HtrA
   104690945 (HTRA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin_2 Trypsin PDZ_6 PDZ_2 Peptidase_S46 PDZ Peptidase_S32 Tricorn_PDZ
Motif
Other DBs
NCBI-GeneID: 104690945
NCBI-ProteinID: XP_019142530
Position
Unknown
AA seq 380 aa AA seqDB search
MFSPSSASGLSEHLCAVALPCSWDCTFVAVHKLWIPTAFVPILLFVQTLEAGKDSAIVLL
PAHPHCSLLPPSPTTVPVPTTPPDLCPPYRHPFLGREVPISNGSGFLVSPDGLIVTNAHV
VANRRRVRVKLASGEMYDAVVQDVDQVADIATIKIKPKHPLPTLPLGRSAEVRQGEFVVA
MGSPFALQNTITSGIVSSAQRGSRELGLAATDMEYIQTDAAIDFGNSGGPLVNLDGEVIG
VNTMKVTSGISFAIPSDRLRKFLQKEEQRKSSWFGNAETKRRYIGVMMLTLTPSILAELK
LRDPSFPDISYGVLIHKVIIGSPAHQAGLKAGDVVLEINGTASRRAEDVYEAVRTQQNLA
LLVRRGYDTLLVSVIPEVTE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgttctcaccatccagcgcctccggcctctcggagcacctctgtgcagtagctctgccc
tgcagctgggattgtacctttgtggctgtgcacaagctctggattcctactgcatttgtg
cctattctcctgtttgtgcagactcttgaggcagggaaggattctgccatcgtgctgctg
cccgcacaccctcactgttccctgctgcctcccagccctaccactgtgcctgtccctacc
actcctcctgacctgtgccctccttacaggcaccccttcctgggccgggaggtgcccatc
tccaacggttcaggcttcctggtgtccccggatgggctgattgtcaccaacgcgcacgtg
gtggcgaaccggcggcgcgtgcgggtgaagctggcgagcggcgagatgtacgacgccgtg
gtgcaggacgtggaccaggtggcggacatcgccaccatcaagatcaaacccaagcacccg
ctgcccacgctgccgctgggccgctcggctgaggtgcggcagggcgagttcgtggtggcc
atgggcagcccctttgctctgcagaacaccatcacctcaggcatcgtcagctcggcgcag
cgcggcagccgcgagctgggcctggccgccaccgatatggagtacatccagaccgatgcc
gccatcgactttgggaactctgggggccccctcgtcaacctggatggcgaggtgattggt
gtgaacaccatgaaggtgacgtcgggcatctcctttgccatcccctccgaccggctgcgg
aagttcctgcagaaggaggagcagcgcaagagctcttggtttggcaatgcagagacgaag
cgccgatacatcggggtgatgatgctgacccttactcccagcatcctggcagagctgaag
ctgcgtgaccccagctttcctgacatctcctatggcgtgctgatccacaaggtgatcatc
ggctccccggcacaccaggcagggctgaaggctggggacgtggtgctggagatcaacggg
acggcgtcgcggcgcgccgaggacgtgtacgaggcggtgcggacacagcagaacctggcc
ctgctggttcggcgtggctacgacaccctgctggtgagcgtcatccccgaggtcaccgag
tag

DBGET integrated database retrieval system