KEGG   Corvus cornix (hooded crow): 104691697Help
Entry
104691697         CDS       T03546                                 

Gene name
MARS2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00450  Selenocompound metabolism
ccw00970  Aminoacyl-tRNA biosynthesis
ccw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    104691697 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104691697 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccw01007]
    104691697 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccw03016]
    104691697 (MARS2)
Enzymes [BR:ccw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     104691697 (MARS2)
Amino acid related enzymes [BR:ccw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   104691697 (MARS2)
Transfer RNA biogenesis [BR:ccw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    104691697 (MARS2)
 Prokaryotic type
   Other AARSs
    104691697 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 104691697
NCBI-ProteinID: XP_010401629
Position
Unknown
AA seq 391 aa AA seqDB search
MFRLSAFRDPLQNWLRDNPRAIFPDPFYQCVLRWLDEDLPDLSVSRERSRLQWGIPVPSD
PTQTIYVWVDALVNYLSVVGYPESHGAWWPAVHHVVGKDILKFHALYWPALLLATGLEPP
ERILVHSHWTVRGQKMSKSLGNVVDPTVCVGQYGVDGFRYFLLRQGVPERDCDYYEEKVV
KLVNSELADALGGLLNRSTAPSINPSNTYPRFSEPCFPKVPNSREAKCTGRASAEDYELV
AAVASLPAQVDSYFEGFQIYKALECIAQCVRQTNGFFQRHRPWKLDRRDGAEQLWLDTIL
HVTLECLRVYGTLLQPVVPHVADKLLSRLAVGPAERGLSGLTFLARYDGKPCPFEGRQLG
PDTGILFHRLGKLETMKKRKQEARVPDKQLL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggctctcagcattccgggatcccttgcagaactggctccgggacaacccacgt
gcgatttttcctgaccctttctaccagtgcgtgctccgctggctggacgaggacttgcca
gacttgtcggtgtcccgcgagcgaagccggctgcagtggggcatccccgtccccagtgac
cccacacagaccatctacgtctgggtggatgccctggtgaactacctgagcgtggtgggg
taccccgagagccacggcgcgtggtggccggccgtgcaccacgtcgtgggcaaggacatc
ctcaagttccacgcgctgtactggccggcgctgctgctggcgacagggctggagcccccc
gagcgcatcctggtgcactcccactggactgtgcggggccagaagatgtccaagagcctg
ggcaacgtggtggaccccactgtgtgcgtggggcagtacggcgtggacgggttccggtac
ttcctgctgcggcagggcgtcccggagcgggattgtgactattacgaggagaaggtggtg
aagttggtgaattcggagctggcagatgcactcggagggctgctgaatcgctccacagcc
cccagcattaaccccagcaacacctacccgcgcttctcagagccctgtttcccaaaggtc
ccgaattccagggaggcaaaatgcacaggcagggcatctgctgaggactatgagctcgtg
gcagcagtggcctcgctgcctgcgcaggtggacagttattttgaaggcttccagatctac
aaggctttggaatgcattgcccagtgtgtgaggcagaccaacggcttcttccagagacac
aggccttggaaacttgaccgaagggatggtgcggagcagctctggctggacaccatcctc
cacgtgacgctggagtgcctgcgcgtgtacgggacgctcctgcagcccgtggtcccacac
gtggcagacaagctgctgtcccggctggctgttgggccagcagagaggggtctctccggg
ctgacgttcctggcacgctatgatggaaagccgtgtccctttgaggggaggcagcttgga
cctgacaccggcatcttgttccacaggctgggcaagctggaaactatgaagaagagaaag
caagaagctcgagtccctgacaaacagcttctgtga

DBGET integrated database retrieval system