KEGG   Corvus cornix (hooded crow): 104691828Help
Entry
104691828         CDS       T03546                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-3 isoform X2
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00232  Caffeine metabolism
ccw00983  Drug metabolism - other enzymes
ccw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    104691828
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    104691828
Enzymes [BR:ccw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     104691828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 104691828
NCBI-ProteinID: XP_010401803
Position
Unknown
AA seq 290 aa AA seqDB search
MDIQEYFARISYQGSHNKPDLATMSDIFQHHIQAVPFENLSIHCGESIELDLEATYNKIV
RKKRGGWCMENNYLLSWVLKTLGYDVTLLGAKVYVPELDAYPDEIDHLLLQVELDGKSYI
VDGGFGMAYQLWQPMELISGTDQPQTPGVFRFQEESGTWYLEKVKRKQCVLNQSTSTSHS
VENEVCRRVYLFTLQPRDIEEFRGCNAHLQTAPDSLFVTKSICSLQTADGIRALVGWKLT
EIKYNYRDNMDLVEIRIIADEEMEKTLKEKFNITLDKKFVPVNTSRLSLF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacatccaggagtattttgccagaatttcttaccagggctcccacaataagccagac
ctggctaccatgtcagatatattccagcaccacatccaagctgtcccttttgaaaacctc
agcatccactgtggggaaagcattgagctggacctggaagcaacgtacaacaagatagtg
aggaagaaacgtgggggctggtgcatggaaaacaactaccttctatcttgggtcctgaaa
actcttggctatgacgtcacccttctgggagcaaaagtttatgtcccagagctcgacgcc
tatccagatgagatcgaccatctgctgctacaagtggagcttgatggcaaatcctacatt
gtggatggggggtttgggatggcctaccagctatggcagccaatggagctgatttcgggg
acggatcagccgcagactcccggggtctttcgtttccaggaggagagcgggacctggtac
ctggagaaggtgaaaaggaagcagtgcgttctcaatcaaagcacctccacttcccacagt
gtggaaaatgaagtctgccgtcgggtttatctctttacccttcagccacgagacattgag
gagttcaggggctgcaatgcccacctgcagacagcacctgactcgctctttgtgaccaag
tccatctgcagcctgcagactgctgacggcatccgggcactggtggggtggaaactcaca
gagataaagtacaattatagggacaatatggatcttgtagaaatcagaatcattgcagat
gaagaaatggagaaaacactgaaggagaaattcaatataacactagacaagaaatttgta
cccgtcaatacaagcaggttgtctctgttctaa

DBGET integrated database retrieval system