KEGG   Corvus cornix (hooded crow): 104692339Help
Entry
104692339         CDS       T03546                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X5
  KO
K08015  Ras association domain-containing protein 5
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104692339 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA SPO22 4HB_MCP_1
Motif
Other DBs
NCBI-GeneID: 104692339
NCBI-ProteinID: XP_010402621
Position
Unknown
AA seq 255 aa AA seqDB search
MHEDACSSCRIRALQERFLFPPCGKGPNENVTHTVEEEKPEPPTVQEIKQKIEKYNAKVT
NCLLMKLNDDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDALKEVNLAEMTDKRTSFYLP
LDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKEMRKDGQVLFQKLPLTEYPLY
LRLLAGPDTDVLSFVLKENETGEVEWDAFSIPELQNFLMILDKEEKDKIQQVHRKYERFK
QRLQQTLKEARGKPG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaagacgcgtgctcctcgtgtcggatccgtgctctgcaggagagattcctcttt
cccccgtgtgggaaggggccgaacgagaatgtaacacacacggtagaagaagaaaaaccc
gagcctccgaccgtccaggagatcaaacagaagattgagaagtacaatgcaaaggtgacc
aactgcctgttgatgaaactgaacgacgatgggacgtacacagggttcatcaaggtgcac
ctgaagctgcgccgccccgtgacggtgccggccggcatccggccccagtccatctacgat
gccctcaaggaggtgaacctggctgagatgacggacaagaggacctccttctacctgccc
ctggatgccatcaagcagctccacatcagcagcacgaccacggtgagcgaagtgatccag
gggctcctgaagaagttcatggtggtggataacccccagaagtttgcacttttcaaggag
atgcggaaagatgggcaagtgctcttccagaagctccctctcaccgaataccccctgtac
ctgcggctgctggcgggccctgacacggatgtgctgagctttgtgctgaaggagaacgaa
actggggaagttgagtgggacgcgttctccatcccagagctgcagaacttcctgatgatc
ctggacaaagaagagaaggacaaaatccagcaagtgcacaggaagtatgagaggttcaaa
cagagactgcaacagaccttgaaagaagccagaggcaaacctggataa

DBGET integrated database retrieval system