KEGG   Corvus cornix (hooded crow): 104692791Help
Entry
104692791         CDS       T03546                                 

Gene name
MRPL53
Definition
(RefSeq) 39S ribosomal protein L53, mitochondrial
  KO
K17434  large subunit ribosomal protein L53
Organism
ccw  Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ccw03011]
    104692791 (MRPL53)
Ribosome [BR:ccw03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    104692791 (MRPL53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 DUF4135
Motif
Other DBs
NCBI-GeneID: 104692791
NCBI-ProteinID: XP_010403351
Position
Unknown
AA seq 109 aa AA seqDB search
MASKMSVVLRPVKSIVVRFCPFEPNVESTRNFLQCIYHKKIQATNTNCQVTADVRHDGSE
PVVDVTFADGDRLIMKGANLTTGEMLAALKSRCNAKDLKEEQKNKKKHP
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaagatgagcgtggtgctgcggccggtaaagagtatcgtggtccggttctgc
cccttcgagcccaacgtggagagcacgagaaattttctccaatgtatttaccataaaaaa
atccaggctactaatacaaactgtcaagtgactgctgatgtgagacatgatggatctgaa
ccagttgtagatgtgacgtttgctgatggagatcgactgataatgaagggagccaacctg
acgacaggggaaatgttagcagcattgaagtccagatgtaatgcaaaagaccttaaggaa
gaacagaaaaacaagaagaagcatccctga

DBGET integrated database retrieval system