KEGG   Corvus cornix (hooded crow): 104692992Help
Entry
104692992         CDS       T03546                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00480  Glutathione metabolism
ccw00590  Arachidonic acid metabolism
ccw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    104692992 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104692992 (GPX2)
Enzymes [BR:ccw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     104692992 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 104692992
NCBI-ProteinID: XP_010403657
Position
Unknown
AA seq 191 aa AA seqDB search
MTVPIAKSFYDLSATSLQGEKVDFGVFRGRVVLIENVASLUGTTVRDYTQLNQLQARYPR
RLVVLGFPCNQFGYQENGTNEEILNTLKHVRPGGGFEPNFTLFQKCQVNGSDTHPVFAYL
KAHLPAPADEAAHLMAEPRFVTWSPVRRSDISWNFEKFLVGPEGEPFRRYSPRVPTAQLE
PDIQRLLKLAK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccccatcgccaagtcattctacgacctgagcgccacctccttgcagggggaa
aaggtggatttcggtgttttccggggccgtgtagtcctgatcgagaacgtggcatcgctc
tgaggcaccacagtgcgggattacacccagctcaaccagctccaagcccgctacccccgg
cggctggttgtgctgggcttcccctgtaaccagtttggataccaggagaacggcaccaac
gaggagatcctcaacaccctaaagcatgtgcggcccgggggtggctttgagcccaacttc
accctgttccagaaatgtcaggtgaacgggagcgacacccatcccgtgtttgcctacctc
aaggctcacctgcccgcaccggccgacgaggccgcacacctgatggccgagccccgcttt
gtcacctggagccctgtgcggcgctccgatatctcctggaattttgagaagttcctggtg
gggcccgagggggaaccgttccggcgctacagcccccgtgtgcccacagcccagctggag
cctgacatccagcgtctcctcaagctggccaagtaa

DBGET integrated database retrieval system