KEGG   Corvus cornix (hooded crow): 104693080Help
Entry
104693080         CDS       T03546                                 

Gene name
AGXT
Definition
(RefSeq) serine--pyruvate aminotransferase isoform X1
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00250  Alanine, aspartate and glutamate metabolism
ccw00260  Glycine, serine and threonine metabolism
ccw00630  Glyoxylate and dicarboxylate metabolism
ccw01100  Metabolic pathways
ccw01200  Carbon metabolism
ccw04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    104693080 (AGXT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104693080 (AGXT)
   00260 Glycine, serine and threonine metabolism
    104693080 (AGXT)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104693080 (AGXT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccw01007]
    104693080 (AGXT)
Enzymes [BR:ccw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     104693080 (AGXT)
    2.6.1.45  serine---glyoxylate transaminase
     104693080 (AGXT)
    2.6.1.51  serine---pyruvate transaminase
     104693080 (AGXT)
Amino acid related enzymes [BR:ccw01007]
 Aminotransferase (transaminase)
  Class V
   104693080 (AGXT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_5 Aminotran_1_2 Pyridoxal_deC Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 104693080
NCBI-ProteinID: XP_010403810
Position
Unknown
AA seq 417 aa AA seqDB search
MLAAAQAASTAPLLWAQLLGTARRGMATSLLRVPPPQGLLRPLAVPERLLLGPGPSNVPP
RIQAAGGRQLLGHMHPEVLQVMDEIKAGIQYAFQTQNRLTLAISGSGHCAMEAALFNLLE
PGDTVLVAINGIWGQRAADIARRLGANVYELLKPPGKYFTPQDIEQGLVQHKPLVLFITH
GESSTGVLQPLEGLGKLCHRHGCLLLVDAVASLGGAPIFMDQQEIDVLYSGSQKVLNAPP
GTAPISFSERAREKLLKRKMKPLSFYLDMGWLANYWGCDEEPRRYHHTAPINSFFSLREG
LAILAELGLESSWEQHRANCTQLCQGLIDLGLELFVKEEKARLPTITTVRVPEGYNWKDI
TAFLMDSHGVEIAGGLGPTVDKVLRIGLMGCNSTGANVDRVLRALQDALNRCHRSRL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctggctgctgctcaggcagcctccactgctcctcttctctgggctcagctcctaggg
acagcacgtcgtggcatggccaccagcctgctccgcgttcccccaccccagggactgctc
cggcccctggccgtgccagagaggctgctgctcgggccagggcccagcaatgtgcccccc
cgcatccaggctgcgggtggtcggcagctcctgggccacatgcaccctgaagtgctgcag
gtgatggatgagatcaaggcaggcatccagtacgccttccagacgcagaaccggctgacc
ctggccatcagcggcagcggccactgtgccatggaggccgccctcttcaacctgcttgag
cccggtgacactgtgctggtggccatcaacggcatctggggacaacgtgccgccgatatt
gccaggaggctgggagccaatgtctatgagctgctgaagcccccaggcaagtacttcact
ccacaagacattgagcagggcctggtgcaacacaaaccattggtgctcttcatcacccac
ggcgagtcctccacaggggtgctgcagccactggaggggctgggcaagctgtgccaccgg
cacggctgcctgctgcttgtggacgcagtggcatcgcttgggggagcccccatcttcatg
gaccagcaggagatcgatgtcctgtactcgggctcccagaaagtcctcaatgcacccccc
ggcactgcccccatctcattcagtgagcgagccagggagaagctgctgaagaggaaaatg
aagcccctgtccttctatctggacatgggctggttggcaaactactggggctgtgacgag
gagccgcggaggtaccaccacacggcacccatcaacagcttcttcagcctgcgggaaggc
ctggccattctggcagaactgggtctggagagctcttgggagcaacaccgggccaactgc
acccaactgtgccagggtctgattgacctggggcttgagctgtttgtgaaggaggagaag
gccagacttcccaccatcaccactgtcagggtgcctgagggctacaactggaaggacatc
acagcctttctgatggacagccacggcgtggagatcgccgggggcctgggccccacggtg
gacaaggtcctgcgcatcggcctcatgggctgcaactcaaccggtgcgaacgtggaccga
gtgcttcgagccctgcaagatgccctgaaccgctgccaccgcagcaggctgtga

DBGET integrated database retrieval system