KEGG   Corvus cornix (hooded crow): 104693425Help
Entry
104693425         CDS       T03546                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00230  Purine metabolism
ccw01100  Metabolic pathways
ccw04270  Vascular smooth muscle contraction
ccw04540  Gap junction
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104693425
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104693425
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104693425
Enzymes [BR:ccw01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     104693425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Motif
Other DBs
NCBI-GeneID: 104693425
NCBI-ProteinID: XP_010404322
Position
Unknown
AA seq 787 aa AA seqDB search
MFIYLLLQYGFINTCLKSLVVEKYGEETWEKLRLQAGVQDSFLTFEVYKDEITMQLVDKA
CKVLGVPADTVLSEFGKYFFEFCKRSGYDHMLRTLGGNLYEFIENLDALHSYLSLSYQEM
NAPSFRVEKNEDGSMNLHYYSDRRGLCHIVPGIISAAALDFFNIEISMKIVNQTEEEERT
GKKEHIVFLVTQTPLFPCKERSEFSSSSRCLVDSEKQFENRLNKEDLGKAKNANGDRGNS
VCPVKKSHWKTLRGIITLGKGKLLRGFDPVYPKSLWIDTKTFCNGLPFHMVFDKELKVKQ
AGVSIQKIVPGLQTMGICLDQYFRIVHPEVPFTISSIQKFINSQFVFQTRREMMPESWKE
RPMLELRGQMMWMESLQCMLYLCSPLLRTLHELEERQMHIADIAPHDVTRDLILLNQQRL
AEMELSNQLERKKEELRILSKHLEEEKKKTEALLYAMLPQHVANQLKEGKRVEAGEFKEC
TVLFSDVVTFTNICAQCEPIQIVLMLNSMYLRFDRLTTVHDVYKVETIGDAYMVVGGVPV
PVPTHAERVANFALGMIMAAKGVQNPVSGNPIQIRVGIHTGPVLAGVVGEKMPRYCLFGD
TVNIASRMESHGVPSKIHLSSSAYQCLKYKNFEITERGEIEVKGKGKMHTYFLIRNKSAT
ENEIMGRPMKDLDSGHESVQSLPEGKTETIPSSHQPATQTQPEKDQTPAIAMKYVDGPTD
AQNSFKRRNQMKVGDLTGKTCDSKSDGSLHGNQQADDSSRPPNQGRVKPAAEEPQNRNVR
SNFCTLL
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgttcatatatttgcttttgcagtatggatttataaacacatgcctgaagtctttggtg
gttgaaaagtatggcgaagaaacatgggaaaaattaaggctgcaggctggagtccaggat
tctttcttgacttttgaggtttacaaagatgagatcacaatgcagctcgtcgacaaagcc
tgcaaagtattaggtgttcctgctgacactgttctgagcgagtttggaaagtatttcttt
gaattctgtaagcgctcaggctatgaccacatgctgaggacactgggtggaaatctctat
gagttcatagagaacctggatgcattgcacagctacctgtccctttcttaccaggagatg
aatgcaccatcttttagagtggaaaagaatgaagatgggtcaatgaatttacattactat
tcagacagaagaggtctgtgccatattgtgccaggaatcatcagtgcagcagccctggat
ttttttaacattgagatttcaatgaaaatagtcaatcaaacagaagaagaagaaagaacc
gggaaaaaagaacatattgtttttcttgtcactcaaacccctctatttccatgcaaagaa
agaagtgaattttcttcctcatctcgatgtcttgttgactctgaaaaacaatttgagaac
cgactgaataaagaggacctaggaaaagccaagaatgcaaatggagacagaggaaactct
gtttgtcctgttaagaaaagtcactggaaaacattaagaggaataatcacattaggaaaa
ggtaagctcctgagaggatttgatcctgtttatcccaagagcctctggattgacacaaaa
acattttgcaatggacttccttttcatatggtttttgacaaagagctcaaagtgaagcaa
gctggggtgagcattcaaaagattgtacctggccttcagaccatgggcatctgcttggat
cagtacttcaggatcgttcacccagaagtaccctttaccatctccagcattcagaaattc
atcaacagccaatttgttttccagactagaagagagatgatgcctgagtcatggaaagaa
cggccaatgctagagctaagaggccagatgatgtggatggagtcccttcagtgcatgctc
tacctctgctcacctttgcttcgcactttgcatgagctggaggagcggcagatgcacatc
gcagacattgcccctcacgacgtgaccagggatttgattctcctcaatcagcagcgactg
gcagagatggagctctcaaaccagctggagaggaagaaggaagagctgaggatcctgtca
aaacacctggaggaagagaagaagaagactgaagctctgctctatgccatgcttccccag
cacgtggccaaccagctgaaagaggggaagcgagttgaggcaggagagttcaaggagtgc
actgtattgttcagtgacgtggtgacctttaccaacatttgtgcccaatgtgagcctatt
cagatagttctcatgttaaattcaatgtacctgagatttgacagactgaccacggtgcat
gacgtgtacaaggtggagacgattggagatgcctacatggtcgtaggtggggtccctgtg
cctgtacccactcatgctgagcgagttgctaattttgccctgggcatgataatggcagcc
aaaggagtgcagaacccagtttctggaaatcctatccaaattcgagttgggatccataca
ggtcctgtcttggctggggttgttggagaaaagatgcctcgttactgcttgtttggagac
acagtgaatattgcttcccgcatggagagccacggtgtcccgagcaaaattcacctgagc
tccagtgcctatcagtgcctaaaatacaagaattttgagattactgaaagaggagaaata
gaagtaaaaggcaaagggaaaatgcacacatacttcctcattagaaataaatctgcaact
gagaatgagattatgggaaggcctatgaaagatttagattctggccatgaatctgttcag
tcccttccagaaggcaagactgaaacaataccaagttctcatcagccagctactcagact
cagccagaaaaggaccagacccccgctattgcaatgaaatatgttgatggccccacagat
gcacaaaacagcttcaaaagaagaaatcagatgaaagttggagatctaacaggcaaaact
tgtgattccaaaagcgatgggagtctccatggcaaccagcaagcagatgatagttctcgt
cctccaaaccagggaagagtcaaacctgctgctgaagagccacagaatagaaatgttcgc
tctaatttttgcactttactctaa

DBGET integrated database retrieval system