KEGG   Corvus cornix (hooded crow): 104694095Help
Entry
104694095         CDS       T03546                                 

Gene name
ACVR2A
Definition
(RefSeq) activin receptor type-2A isoform X1
  KO
K04670  activin receptor type-2A [EC:2.7.11.30]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04060  Cytokine-cytokine receptor interaction
ccw04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    104694095 (ACVR2A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    104694095 (ACVR2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccw01001]
    104694095 (ACVR2A)
Enzymes [BR:ccw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     104694095 (ACVR2A)
Protein kinases [BR:ccw01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   104694095 (ACVR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal FTA2 APH Toxin_TOLIP
Motif
Other DBs
NCBI-GeneID: 104694095
NCBI-ProteinID: XP_010405486
Position
Unknown
AA seq 521 aa AA seqDB search
MGAATKLAFAVFLISCSSGAILGRSETQECIYYNANWEKDKTNRSGIEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRNDCIEKKDSPEVFFCCCEGNMCNERFFYFPEM
EVTQPTSNPVTPKPPLFNTLLYSLVPIMGIAVIVLFSFWMYRHHKLAYPPVLVPTQHAFH
IMIEDPGPPPPSPLMGLKPLQLLEIKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNE
YEIYSLPGMKHDNILQFIGAEKRGSSIDVDLWLITAFHEKGSLTDFLKANVVSWNELCHI
AQTMARGLAYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKS
AGDTHGQVGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYM
LPFEEEIGQHPSLEDMQEVVVHKKKRPVLRECWQKHSGMAMLCETIEECWDHDAEARLSA
GCVEERIIQMQKLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgggagctgctactaagttggcgttcgctgtttttcttatctcttgttcatcaggtgcc
atcctgggcagatcagaaacacaggagtgcatctactacaacgctaactgggaaaaggat
aaaaccaatcgcagtgggatcgagccctgctatggtgataaagataaaaggcgacactgc
tttgctacatggaagaatatttctggatcaattgaaattgtgaagcaaggctgctggctg
gatgacatcaattgttatgacaggaatgattgcatagagaagaaggacagccctgaggtg
tttttctgttgctgtgagggcaacatgtgcaacgagcgcttcttctacttcccggagatg
gaggtcacgcagccaacttccaatcctgttacgccgaagccacctctgttcaacaccttg
ctgtattccttggtgcctatcatgggaattgcagtgatcgtgctcttttccttctggatg
tacagacatcacaagctggcctatcctcccgtgcttgttcccacccagcacgcctttcat
ataatgattgaggatcctgggcctcccccaccatctccgttgatgggtctgaagccgctg
cagctcctggagatcaaagccagggggagatttgggtgtgtgtggaaagctcagctgctc
aatgaatacgttgcagtcaaaatattccccatccaggacaagcagtcgtggcagaacgag
tatgagatctacagcctgcccgggatgaagcacgacaacatcctgcagttcatcggcgcc
gagaagcgcggctccagcattgacgtcgacctgtggctcatcaccgccttccacgagaag
gggtccctgacggatttcctgaaggccaacgtggtgtcgtggaacgagctgtgccacatc
gcccagaccatggcccgtggcctggcctacctgcacgaggacatcccggggctcaaggat
ggccacaagccggccatctcccacagggacattaaaagcaagaatgtgctgctgaaaaac
aacctcacagcttgtattgctgatttcggtctagctttaaagtttgaggctggaaagtct
gcaggagacacccatggacaggtgggcacccgcaggtacatggctccggaggtgctcgaa
ggtgctatcaacttccaaagggacgcgttcctgaggatagacatgtacgccatgggattg
gtcctctgggaattggcctcgcgctgcacggccgccgacggccccgtggacgagtacatg
ctgccttttgaggaggagattggccagcacccgtccctggaggacatgcaggaagttgtg
gtgcacaaaaagaagaggcctgtcctaagggagtgttggcagaaacattctggaatggcg
atgctgtgcgagaccatcgaggagtgctgggatcacgacgccgaggcccggctgtccgcg
ggctgtgtggaggagaggatcatccagatgcaaaaactcactaacattataacaacagag
gacattgtgactgtggtcacaatggtgacaaacgttgactttcctcccaaagaatccagt
ctatga

DBGET integrated database retrieval system