KEGG   Corvus cornix (hooded crow): 104694896Help
Entry
104694896         CDS       T03546                                 

Gene name
ERLIN2
Definition
(RefSeq) erlin-2
  KO
K23341  erlin
Organism
ccw  Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ccw04121]
    104694896 (ERLIN2)
Ubiquitin system [BR:ccw04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    104694896 (ERLIN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346
Motif
Other DBs
NCBI-GeneID: 104694896
NCBI-ProteinID: XP_019146730
Position
Unknown
AA seq 313 aa AA seqDB search
GGSRGDVAVSEPRGLQDLCRENPSLKPLSFDLLQTTLQTDEVKNVPCGTSGGVMIYFDRI
EVVNFLIQSAVYDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLK
LALQQDLTTMAPGLIIQAVRVTKPNIPETIRRNYELMESEKTKLLIAAQKQKVVEKEAET
ERKKALIEAEKIAQVAEITYGQKVMEKETEKRISEIEDAAFLAREKARADAECYTAMKVA
EANKLKLTPEYLQLMKYKAIAANSKIYFGKDIPNMFMDSAGSQRKSAEGLAEGIQDEDGA
GTSEDTKLLHNIN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ggagggtcccggggggacgtggctgtgtcagagccccgtgggctgcaggatttgtgccgg
gaaaatccctctcttaagcctctttccttcgatctcctccagaccacgctgcagacggac
gaggtgaaaaatgtcccgtgtggcaccagtggaggagtgatgatttatttcgacaggatc
gaggtggtgaatttcctcatccagagcgcggtgtacgacatcgtgaagaactacacggcc
gactacgacaaggccctcatcttcaacaagatccaccacgagctgaaccagttctgcagt
gtccacacgctgcaggaggtttacatcgagctgtttgatcaaattgatgaaaaccttaaa
ctggccttgcagcaagacctaaccacgatggcccctggattaattatacaggcagttcga
gttacaaagccaaacatccctgaaacaatccggaggaattatgagctcatggagagcgag
aagacaaagctgctgatcgcggcacagaagcagaaggtggtggagaaggaggcagagaca
gagaggaagaaagccctgatcgaggcagaaaagattgcacaagttgctgaaataacttat
ggacagaaagtgatggaaaaggaaacagagaagcgaatttcagagattgaagatgctgca
tttcttgcacgagagaaggcgagagctgatgctgagtgttacactgctatgaaggtggcc
gaggccaacaagctcaagttaactcccgagtacttgcagctgatgaagtacaaggcaatc
gcagccaacagcaagatctactttggcaaagatattcccaacatgttcatggactctgca
gggagccagagaaaatctgcagagggactggcagagggaatccaagatgaggacggggca
ggaaccagcgaggacacaaaactacttcataacatcaactga

DBGET integrated database retrieval system