KEGG   Corvus cornix (hooded crow): 104695103Help
Entry
104695103         CDS       T03546                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00010  Glycolysis / Gluconeogenesis
ccw00562  Inositol phosphate metabolism
ccw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104695103 (MINPP1)
   00562 Inositol phosphate metabolism
    104695103 (MINPP1)
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     104695103 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     104695103 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 104695103
NCBI-ProteinID: XP_019146928
Position
Unknown
AA seq 275 aa AA seqDB search
MPFVEVEVNDSLMRFFDHCAKFVALVEENDAAMCQVNAFKEGPEMKKVLEKVASALCLPV
EELNADLVQVAFLTCSYELAIKNVTSPWCSLFSEEDAKVLEYLNDLKQYWKRGYGYDINS
RSSCILFQDIFQHLDKAVEESKSSKPISSPLIVQVGHAETLQPLLALMGYFKDDEPLLAN
NYAWHTQRKFRSGRIVPYAANLVFVLYHCDHVNASQEEYQVQLLLNEKLLSFHHSNETIS
TYADLKDYYKDILENCHFKEECELPKVNITAVDEL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcgtggaggttgaagtgaacgactccctgatgcggttctttgatcactgcgcc
aagtttgtggccctggtggaggagaatgacgcggccatgtgccaggtgaacgccttcaaa
gaggggcccgagatgaagaaagtcctggagaaggtcgccagtgccttgtgtttgccggtg
gaggagctaaatgcagatcttgttcaagtggcttttctcacctgctcatacgagctggct
ataaaaaatgtgacctccccatggtgttcactcttcagtgaagaagatgccaaggtgctg
gaatacctgaatgacctgaagcaatactggaagagaggatatggctatgacatcaacagt
cgctccagctgcattttattccaagatatcttccagcatttggacaaagcagtggaagag
agcaaaagctccaaacccatttcttcgcctttgattgtccaagttgggcacgcagagacc
ctccagcccctgcttgccctgatgggttacttcaaagatgatgagcctctcctggccaac
aactacgcctggcacacgcagcggaaattccgcagcggccgcattgtgccttacgcagcc
aacctggtgttcgtgctctaccactgcgaccacgtgaacgcctcccaggaggagtaccag
gtgcagctgctgctcaatgagaaactgctgtccttccatcactccaacgagaccatctcc
acctacgcggacctcaaggactactacaaggacatcctggaaaactgccacttcaaagag
gagtgcgaattgcccaaagtcaacatcactgctgtggatgagctgtga

DBGET integrated database retrieval system