KEGG   Corvus cornix (hooded crow): 104695920Help
Entry
104695920         CDS       T03546                                 

Gene name
MGAT2
Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00510  N-Glycan biosynthesis
ccw00513  Various types of N-glycan biosynthesis
ccw01100  Metabolic pathways
Module
ccw_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    104695920 (MGAT2)
   00513 Various types of N-glycan biosynthesis
    104695920 (MGAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccw01003]
    104695920 (MGAT2)
Enzymes [BR:ccw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     104695920 (MGAT2)
Glycosyltransferases [BR:ccw01003]
 Glycan extension
  N-Glycan
   104695920 (MGAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2 Gp45_2
Motif
Other DBs
NCBI-GeneID: 104695920
NCBI-ProteinID: XP_010408280
Position
Unknown
AA seq 139 aa AA seqDB search
MKTWKSTEHNMGMAFGRDTYQKLIECTDAFCTYDDYNWDWTLQHLTVSCLPKFWKVLVPE
IPRIFHTGDCGMHHKKSCRPSTQSAKIDSLLNSNQQYLFPEVMSVSKRYSMAPLSPHVKN
GGWGDIRDHELCKSYRRLQ
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgtggaagtccacggagcacaacatgggcatggccttcggcagagacacgtac
cagaagctcatcgagtgtacggacgccttctgcacctacgatgactacaactgggactgg
actctgcagcacttgactgtctcttgtcttccaaagttctggaaagtgctggttcccgaa
atccccaggatttttcacacgggggactgtggcatgcaccacaagaaatcctgcagaccg
tccacccagagtgccaaaatcgactctctcttgaacagcaaccaacagtacctgtttccc
gaggtgatgagtgtcagtaaaaggtactccatggctcccctgtcccctcacgtcaagaac
ggagggtggggagacatcagggaccacgaactctgtaagagttaccgcagactccagtga

DBGET integrated database retrieval system