KEGG   Corvus cornix (hooded crow): 104695929Help
Entry
104695929         CDS       T03546                                 

Gene name
ABHD12B
Definition
(RefSeq) protein ABHD12B
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ccw  Corvus cornix (hooded crow)
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccw01002]
    104695929 (ABHD12B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccw04147]
    104695929 (ABHD12B)
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104695929 (ABHD12B)
Peptidases [BR:ccw01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   104695929 (ABHD12B)
Exosome [BR:ccw04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   104695929 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Say1_Mug180 Peptidase_S9 Cutinase DUF676 LIDHydrolase Lipase_3
Motif
Other DBs
NCBI-GeneID: 104695929
NCBI-ProteinID: XP_019147748
Position
Unknown
AA seq 381 aa AA seqDB search
MSVTVLFQPGLGVLPQTVSNCHGWDWEWGACSPAPQNPWDGGGGCANTCLPCRAQHSWLP
GLRTLLLAPLLTYISVPFLVRLFPSVLTKFVYLNFLAFPFFVDFRRPELLVSNTISLHLT
TEPGVTVGIWHTVPGSRGAEAQGKDQRWYEEALADAHPVIIYLHGNGGTRAASHRVQFLK
TMGAADFHILALDYRGYGDSSGHPTESGFTTDVLALYDWAKARSGNSSIVFWGHSLGTGI
ATNAVRKLQEERGVQADAVVLESPYTNIREAAANIPLTKIYRQFPGFEYLILDSLARAGM
FFRSDENVKVLGCPLLILHAEDDGVVPPKLGRKLYETAREAYKDKSKVKFVTFPEKLGLG
HDYISFHPELPALVKDFLNMK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgactgtgcttttccagccaggactcggggtgttgccacagactgtatccaac
tgtcatggttgggattgggaatggggagcctgctctcctgcaccccaaaacccttgggat
gggggtgggggatgtgctaacacatgcctcccttgcagggcccagcattcctggctccca
ggactgcgcacgctcctcctggccccgctcctcacctacatctccgtgcccttcctcgtc
cgcctcttccccagcgtgctcaccaaatttgtctacctgaacttcctggccttccccttc
ttcgtggactttcggcggccggagctgctggtgagcaacaccatcagcctgcacctcacc
accgagccgggcgtcaccgtcggcatctggcacacggtgccgggcagcagaggggccgag
gcgcagggcaaggaccagcgctggtacgaggaggctcttgctgatgctcaccccgtgatc
atctacctgcacggcaatgggggcaccagggctgcgagtcaccgcgtccagttcctgaag
acgatgggggctgctgacttccacatcctggctcttgactacagaggctatggggactcc
agtggacaccccacagagagcggtttcaccacagatgtcctggcactctatgactgggca
aaagcacggagtgggaacagcagcatcgtcttctggggacactccttggggacagggatt
gccaccaatgcagtgaggaagctgcaggaggagcgaggggtccaggctgatgctgtcgtc
ctggagtctccctacaccaacatccgagaggcggccgccaacatccccctcaccaagatc
taccggcagttcccgggctttgagtacctcatcctggactccttggctcgggcaggaatg
ttcttccgcagtgatgagaacgtgaaggtgctgggctgccccctcctcatcctgcacgca
gaagatgatggagtcgtgcctccgaagctgggacgcaagctctatgagacagcacgcgaa
gcctacaaggacaaatccaaggtgaagttcgttacctttcctgagaagctgggcttgggc
cacgactacatctccttccacccagagctgcctgccctggtgaaagacttcttaaacatg
aagtga

DBGET integrated database retrieval system