KEGG   Corvus cornix (hooded crow): 104696009Help
Entry
104696009         CDS       T03546                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw04010  MAPK signaling pathway
ccw04260  Cardiac muscle contraction
ccw04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104696009 (CACNG5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104696009 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    104696009 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccw04040]
    104696009 (CACNG5)
Ion channels [BR:ccw04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   104696009 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716
Motif
Other DBs
NCBI-GeneID: 104696009
NCBI-ProteinID: XP_010408384
Position
Unknown
AA seq 279 aa AA seqDB search
MLLGMSACSRKALTLLSSVFAVCGLGLLGISVSTDYWLYLEEGIVQPQNQTAEIKLSLHS
GLWRVCFLAGEERGRCFTIEYVMPMNIQLTSESTINVLKMIRSATPFPLVSLFFMFIGFI
LSNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDSESFFNYKYG
WSFAFSAISFLLTESAGVMSVYLFMKRYTAEDLYRPHPGFYRPRLSNCSDYSGQFLHPDT
WGRGRSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgctgttgggaatgagcgcctgcagcaggaaggcgctgaccctgctcagcagcgtgttc
gccgtctgcggcctcggcctcctgggcatctccgtcagcactgattactggctctacctg
gaggagggcatcgtccagccccaaaaccagacagccgagatcaagctgtcgctgcactca
gggctctggagggtctgctttctggcaggtgaggagcgtggccggtgcttcaccatcgaa
tatgtgatgcccatgaacatccagctgacatctgaatccacaatcaatgtcctgaagatg
atccgctcagccacccccttccctctggtcagcctcttcttcatgttcatcggcttcatc
ctgagcaacattggccacatccggcctcacaggaccatcctcgccttcgtctcagggata
ttcttcatcctgtcaggtctgtcactggtggtggggctggtcctctacatatccagcatt
aatgacgagatgctcaacaggaccaaggactcggagtcgttcttcaattacaaatatggg
tggtcctttgccttctctgccatctcgttccttctcacagagagtgccggggtgatgtct
gtgtacctgttcatgaagcgctacacggccgaggacctctaccgaccccaccctggcttc
taccggccccgcttgagcaactgctccgactactcagggcagttcctgcacccagacacg
tggggacggggccgcagcccctcggacatctccagcgaggcgtccctgcagatgaacagt
aactacccagccctgctcaagtgccccgactatgaccagatgtcctcgtccccctgctga

DBGET integrated database retrieval system