KEGG   Corvus cornix (hooded crow): 104697986Help
Entry
104697986         CDS       T03546                                 

Gene name
ACSL6
Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 6 isoform X3
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00061  Fatty acid biosynthesis
ccw00071  Fatty acid degradation
ccw01100  Metabolic pathways
ccw01212  Fatty acid metabolism
ccw03320  PPAR signaling pathway
ccw04146  Peroxisome
ccw04216  Ferroptosis
ccw04920  Adipocytokine signaling pathway
Module
ccw_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    104697986 (ACSL6)
   00071 Fatty acid degradation
    104697986 (ACSL6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104697986 (ACSL6)
  09143 Cell growth and death
   04216 Ferroptosis
    104697986 (ACSL6)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104697986 (ACSL6)
   03320 PPAR signaling pathway
    104697986 (ACSL6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ccw01004]
    104697986 (ACSL6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccw04147]
    104697986 (ACSL6)
Enzymes [BR:ccw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     104697986 (ACSL6)
Lipid biosynthesis proteins [BR:ccw01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   104697986 (ACSL6)
Exosome [BR:ccw04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   104697986 (ACSL6)
  Exosomal proteins of breast cancer cells
   104697986 (ACSL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C DUF347
Motif
Other DBs
NCBI-GeneID: 104697986
NCBI-ProteinID: XP_010411381
Position
Unknown
AA seq 698 aa AA seqDB search
MQAQEILRSLRLPEFDDLSQFFRNLPATALVGIGAFAAVVAYWFASRPRAVKPPCDLRMQ
SEEVEGLAGARRSVIGDSPQLLTHYYDDARTMYEVFRRGFSISENGPCLGFRKPKQPYQW
LSYKEVAERAEALGSGLLQQGCKPSTKQFIGVFAQNRPEWIISELACYTYSMVVVPLYDT
LGPGAIRYIVNTADISTVICDKPEKARILLDHVERRETPGLSSIILMDPFEKELMERGKR
CGVHIQTMQEVEDCGRESRHVPVPPRPEDLSIVCFTSGTTGNPKGAMLTHGNVVADFSGF
LKVTESQWSPTCEDVHISYLPLAHMFERMVQSVVYCHGGRIGFFQGDIRLLSDDMKALRP
TIFPVVPRLLNRMYDKIFSQADTSLKRWILEFAARRKKAEVRNGIIRNDSLWDKLFFNKI
QASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHV
GAPLPCNLIRLKDVEELNYFASKGEGEICVKGPNVFKGYLKDEERTAEALDQEGWLHTGD
IGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYIRSDPVAQIYVHGDSLQAFLVGI
VVPDSEVMPGWAKKRGFEGTYAELCKNKELQQAIMEDMVRLGKESGLHSFEQVKAIYIHS
DMFSVQNGLLTPTLKAKRPELRDYFKKQIEELYSSISI
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctcaggaaatcctgcggagtctgcggctccctgagttcgatgacctcagccag
ttcttccgcaacctaccagccacagctctggtgggcattggtgcctttgcggctgttgtt
gcctactggtttgccagccggcccagggccgtgaagccgccctgcgacctgcgcatgcag
tcggaggaagtcgagggcctggctggggcgcgccgctcggtgatcggggacagcccgcag
ctgctgacacactactacgatgatgccaggaccatgtatgaggtcttcaggaggggattc
agcatctctgagaacggcccctgcctggggttcaggaagcccaagcagccctaccagtgg
ctgtcctacaaggaggtggctgaaagagcagaagctctgggttcgggccttttgcagcag
ggctgcaagccatccacaaaacagttcattggtgtcttcgctcaaaaccgtccagagtgg
atcatctctgagctggcttgctacacctactccatggtggtggttcccctgtatgacacc
ttaggtcctggagccattcggtacattgtcaacacagctgacatttccacggtcatttgt
gacaagcctgaaaaagccaggatactccttgaccatgtggagaggagagaaacaccaggc
ctgagctccatcatcctgatggacccatttgagaaggagctgatggagagagggaagcgc
tgtggggttcacatccagaccatgcaggaggtggaggactgtggccgtgagagtcgacat
gtgcctgtgcctcctcgaccagaagatctgtcaattgtctgttttactagtggcactaca
ggaaatcccaaaggtgctatgctgacccatggaaatgtggtggcagatttttcaggcttt
ttgaaagtgacagagagtcagtggtctcctacttgtgaggatgtacacatttcctatttg
cctttagcacacatgtttgagagaatggtacagtctgtcgtatactgccatggagggcga
attggcttcttccaaggagatattcgcctcctgtctgacgatatgaaggcactgcggcca
accatcttccctgttgtgcctcggctgttgaacagaatgtatgacaagatcttcagccag
gctgacacctcgctcaagcgctggatcctggaatttgctgcaagacggaaaaaggccgaa
gttcgaaacggcatcattagaaatgacagtttgtgggataaacttttctttaataaaata
caggcaagtcttggggggtgtgtccgcatgatagtgacaggtgctgccccagcgtccccg
actgtcctgggcttcctccgcgcggccctcggatgccaggtttatgaaggctatggccaa
acagaatgcacagctggatgcacctttacaactccaggtgactggacatcaggtcatgta
ggagcccctttgccctgtaacttaatcagattgaaggatgtggaagaactgaattatttt
gcttccaaaggagaaggagagatctgtgtgaaaggacccaatgtgttcaaaggttacttg
aaagatgaagagaggacagctgaggcactggaccaggagggctggcttcacacaggagac
attggaaaatggttacctaatgggacccttaaaattattgatcggaaaaagcatatattt
aaacttgctcagggagaatatattgcaccggagaagatagagaatatctatatccgcagt
gaccctgttgctcaaatctatgtccacggagacagcctgcaggctttcctggtgggaatt
gtggtgcctgattccgaagttatgccaggttgggcaaagaaaagagggtttgaaggaaca
tatgcagaactctgtaaaaataaggaactgcagcaagcgataatggaagacatggtacgg
ttagggaaggagagtggacttcactcctttgagcaggtcaaagccatttatattcactct
gatatgttctcggtgcaaaacggtttgttgacaccaacattaaaggctaagagaccagaa
ctgagagattacttcaaaaaacaaatagaagagctatattcaagcatctccatctga

DBGET integrated database retrieval system