KEGG   Corvus cornix (hooded crow): 104698623Help
Entry
104698623         CDS       T03546                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ccw  Corvus cornix (hooded crow)
Pathway
ccw00564  Glycerophospholipid metabolism
ccw00565  Ether lipid metabolism
ccw00590  Arachidonic acid metabolism
ccw00591  Linoleic acid metabolism
ccw00592  alpha-Linolenic acid metabolism
ccw01100  Metabolic pathways
ccw04010  MAPK signaling pathway
ccw04217  Necroptosis
ccw04270  Vascular smooth muscle contraction
ccw04370  VEGF signaling pathway
ccw04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ccw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104698623
   00565 Ether lipid metabolism
    104698623
   00590 Arachidonic acid metabolism
    104698623
   00591 Linoleic acid metabolism
    104698623
   00592 alpha-Linolenic acid metabolism
    104698623
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104698623
   04370 VEGF signaling pathway
    104698623
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    104698623
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104698623
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    104698623
Enzymes [BR:ccw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     104698623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 104698623
NCBI-ProteinID: XP_019137710
Position
Unknown
AA seq 844 aa AA seqDB search
MASSACSPLDWFIQANLHRKIGIRRRDHERPCSAEDEPEVPQLCWLSVKIISMRNLRKAD
LWSQTDCYVKLWLPTASCQEAQTRTVRNCRNPVWNETFHFVIQSEVKNILELTVCDEDTF
TPDDQLMTVRFDVAKIQPGEKVRLHFELNPENQEELEVEFLLENIPGVSEKIITNGVLVS
REVSCLEVHVNETKMKSSHKRRDFTFTMKGSYEEIQDISKGPHSRPGSSETTRFHYIKHS
QPRLLMTLPKEHFFCCHGSGRREMDVSNPLAVPLHSLDLGKKVTVMRGESYEVSVNEENS
CKNLDLRLGFDLCAEEKDFIGKRKKVVAAALKNVLHLDEDLQEDEVPVVAVVTAAGGVRS
MTAMFGSLLALQELGVLDCVSYISGLSATTWTMSKLYEDANWSQKDLSGPIGDIRKHVTK
SKLCCFSLDHMKYYENKLCERKQEGHKVSFTDLWGLFIDCMLHDQESTHKLSDQQLAVKQ
GQNPLPIYLSLNVKDDFSTLDFKEWVEFTPYEVGLLKYGAFVRSEDFGSEFFMGHRMKKI
PESHICFLEGTWSNIFSQSFMDAVYLSGHSEHFWHRWTRDTERDIGDHPALPKKPHEQTT
CLSIPKGYLSKSLREMLTGRPVVSTYHNFLKGLQLHNKYLDNESFCMWKDTVLDSSPNQL
NEMSDYLKLIDTAFFINTSCPPILRPERKVDVILHLNYSGGSQTLPLDLFSEYCLEHGIP
FPSTELSQEDREHLKECYVFEDSLEAPILAYFPLVCDTFQKYKAPNVERGPTEMEQGRVD
VSTCAAPYGTGLLTYTEENFNKLLNLCSYNILNNKHLILQALRTAVERKKRLKKYSSPNS
SKHS
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtcggcctgttcacctttggattggttcatccaagcaaacctgcacaggaag
attggaatcaggaggagggatcatgaaagaccgtgcagcgctgaagatgagccagaagtg
cctcagttgtgctggctttctgtaaaaattataagcatgagaaatctccgcaaagcggat
ctgtggagccagactgattgctatgtcaagctgtggctgccaacagcttcatgtcaggaa
gcccagacaagaactgtacgcaactgcagaaaccctgtctggaatgaaactttccacttc
gtgatacagagtgaagtaaagaacatcctggagctgacagtctgtgatgaggatactttt
acaccagatgaccagcttatgactgttcgctttgatgtggctaaaatccaacctggagaa
aaagttcgcctgcattttgagttgaatccagagaatcaggaagaactagaagtggaattt
ctgctggaaaacataccaggtgtatctgagaagataattactaatggcgtactagtgtct
cgtgaagtttcctgtttggaagtacatgtgaatgaaacaaaaatgaagagttctcacaaa
aggagagatttcacattcacaatgaaaggatcttatgaagaaatccaggatatttccaaa
ggtcctcactccagaccaggaagcagtgaaaccaccaggttccactatatcaaacacagt
caacccagactgctcatgaccctgccaaaggagcattttttctgttgtcatggctcaggt
aggagggaaatggatgtgagtaatcccctggctgtgcctctccattctttggacttggga
aagaaagtgacagtgatgagaggggaatcttatgaagtttctgtgaatgaggaaaatagt
tgcaagaatttagatttgcggttggggtttgatctgtgtgcagaggaaaaggatttcatt
ggtaaaaggaagaaggtggttgctgctgctctgaaaaatgttcttcatctagatgaagac
ctgcaggaggatgaggtgccagtggtggcagtcgtgactgcagcagggggagtgcggtcc
atgacggctatgtttggcagtcttctggctctccaggagctgggtgttttggactgtgtg
tcatacatcagtggcttatctgccacaacatggaccatgtcaaagttatatgaagatgca
aattggtcacaaaaggatctcagtgggccaattggtgatatcaggaaacacgtgaccaag
agcaagctgtgctgtttctctttggatcatatgaaatactatgaaaataagctttgtgag
agaaagcaagaggggcacaaggtgtcctttacagatttatggggactcttcattgattgt
atgctacatgatcaggagagtactcacaaactctcggatcagcaactagcagttaagcag
gggcagaatccactccccatatacctgtccctcaatgtcaaggatgatttcagcactttg
gattttaaagagtgggtggagttcacaccttacgaggtaggtctcctgaaatatggggcc
tttgttcgttcagaggattttggtagtgagttcttcatgggtcaccggatgaagaagatc
ccagaatcccacatctgcttcttggaaggcacatggagcaatatattttcccagagtttt
atggatgctgtctacctctcaggtcattcagaacacttctggcacagatggactcgagac
actgagcgtgacattggggaccatcctgctctgcccaagaagcctcatgaacagacaacc
tgcttatccattcccaaaggttacctttccaaaagtcttcgagagatgttgactggacgg
ccagtggtttcaacttaccataattttctcaagggcttgcagctacataacaaatatttg
gacaatgagagcttttgcatgtggaaagacacagtgctggattcttctcccaaccagctg
aatgaaatgagtgactatctcaagctgatagatacagctttcttcatcaacaccagctgc
ccacccattctgaggccagagaggaaagtggatgtcattctccatttaaattacagtgga
ggatcacagactctgccactggacctattctcagagtactgtttggagcatgggatccca
ttccccagcacagagctgagccaggaagaccgggaacacctgaaggagtgctacgtgttt
gaggatagcttagaggcaccaatcttggcttattttccactggtgtgtgataccttccaa
aaatacaaggcaccgaatgtggagcgtggtcccacagagatggagcagggaagagtagac
gtgtccacctgtgctgctccctatggcactggcctgcttacatacactgaagagaatttc
aacaaactccttaacctgtgcagctacaacatcctgaataataaacatttgattcttcag
gctttgcgaactgcagtggaacgaaagaagcgacttaaaaagtattcatcacctaattca
agtaaacactcttaa

DBGET integrated database retrieval system